PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa016558
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 771aa    MW: 86288.7 Da    PI: 6.7718
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58695427PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1162e-36149225177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +Cqv++Ce+d+se+k yh+rh+vC  ++ a++v+++gl++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k 
  Lsa016558 149 RCQVPSCEVDISELKGYHKRHRVCLRCATATTVVLDGLNKRYCQQCGKFHILSDFDEGKRSCRRKLERHNNRRRRKP 225
                6***********************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.3E-27144211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.539147224IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.23E-33149227IPR004333Transcription factor, SBP-box
PfamPF031107.7E-27150224IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MHNPPPPSSP SPPSPPQQPP SLNMDSIDES STLIWDWSQF LDFNIDDHLP LPGEESNHSS  60
AIPTSQELYP IDNPQVEPVP DSFPVNSTSN TNDRVRKRDP RMACSNFLAG RIPCACPELD  120
ALLVAEEEEG APGKKKSRST TARTASSSRC QVPSCEVDIS ELKGYHKRHR VCLRCATATT  180
VVLDGLNKRY CQQCGKFHIL SDFDEGKRSC RRKLERHNNR RRRKPSETKT SGLQSADYDD  240
AYDEAGKATK CTTSEAAGEE KSLIAPGVHN SLLGPTHAQI IHSDSIPSLA VSGETQTDEE  300
KEKGNHSPSY CDDKSAFSSV CPTGRISFKL YDWNPAEFPR RLRHQIFQWL SSMPVELEGY  360
IRPGCTILTI FIAMPTVMWV KLNEDPVVCI HELLSSPRNL LSGRDTFFVN LNSMIFGVMK  420
GGRSVIKIKT GEKAPKLHYI EPTCFEAGKP IEFLACGSNL LQPRLRFLVS FAGKYMTNEA  480
SVSPSCNQSE TSTTNLDHQL LKISIPHTEL DVFGPGFIEV ENESGLSNFI PILIADEEVC  540
SEIKIMQMKY YSKDSESIAV FRVKQSKFSE LLVDMAWLLK QPIVEEIECV MMSSQLQRFT  600
CVLDFLIEYE STTVLKRILK CIKMRIMKNE SDGILIQGTV NHATEVLHQR LNKKVNQEDE  660
VLPFVSTVNQ DMVVANRMPI PTSMDKSETI ALLNAEYIMS VTPGKEQHPV GPTNRIFTYN  720
TNKNNRLFPT RPLILVATVV TLCFGICAVV FHPHKAAAIA ITIRRCLFDD K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A5e-46145225181squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210222RRKLERHNNRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023737135.10.0squamosa promoter-binding-like protein 7
TrEMBLA0A2J6K8460.0A0A2J6K846_LACSA; Uncharacterized protein
STRINGVIT_05s0020g02160.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.20.0squamosa promoter binding protein-like 7