PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa016181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 246aa    MW: 27215.2 Da    PI: 9.908
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-41473PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM63.85.1e-2075678128
        NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                + sgyWkatg+dk +++ +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Lsa016181   7 AGSGYWKATGTDKVITT-GGRRVGIKKALVFYVGKAPKGNKTNWIMHEYRL 56 
                569************99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100527.6811112IPR003441NAC domain
SuperFamilySSF1019411.96E-25766IPR003441NAC domain
PfamPF023651.9E-9856IPR003441NAC domain
SuperFamilySSF1019411.96E-25100113IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
XALWPVAGSG YWKATGTDKV ITTGGRRVGI KKALVFYVGK APKGNKTNWI MHEYRLSEPQ  60
RKNGSSRVIR SISDHSVXLL IKISVSFSRF LIWVLILVQQ LDDWVLCRIY KKNSSAQKHI  120
SGGAPTTEQS HGSSSSSSSQ FDDVLESLPE IEDRFFNLPR INSLKTFQQE DQKVNLQKFD  180
SGNYDWASIA AFGLPEPATG SQAPTTANTA MNVIPSMAPA TTYTMDATFG RSVEDEVQSG  240
IRSQRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-38611895174NAC domain-containing protein 19
3swm_B3e-38611895174NAC domain-containing protein 19
3swm_C3e-38611895174NAC domain-containing protein 19
3swm_D3e-38611895174NAC domain-containing protein 19
3swp_A3e-38611895174NAC domain-containing protein 19
3swp_B3e-38611895174NAC domain-containing protein 19
3swp_C3e-38611895174NAC domain-containing protein 19
3swp_D3e-38611895174NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095243.14e-77PREDICTED: NAC domain-containing protein 72-like
TrEMBLA0A124SHT01e-108A0A124SHT0_CYNCS; No apical meristem (NAM) protein
STRINGSolyc07g063410.2.13e-71(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-53NAC family protein