PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa016139
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 282aa    MW: 31293.3 Da    PI: 9.7176
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58678566PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.53.1e-25206250145
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Lsa016139 206 DPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEG 250
                79****************************************986 PP

2QLQ65.21.6e-22135171137
        QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                ++FT++Q+++L++Q+l+yKy++an+PvP++Ll +++k
  Lsa016139 135 GPFTPSQWMELEHQALIYKYFVANVPVPSHLLTPLRK 171
                59********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.2E-13135171IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.771136171IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.5E-15136169IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.954206250IPR014977WRC domain
PfamPF088791.4E-21207249IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDFGITPFHN TQFFNHDEKT NGSGFNKQER SDPDPPDDQE LFLRTSKSSR TDYFDQPTKT  60
MSMRSDSLLS VSATDTNNML SFSSSSSSSS SAIKDANQSS LFSFYQPSPS YIRNTGYGYG  120
GLQTGMHMPV SRYKGPFTPS QWMELEHQAL IYKYFVANVP VPSHLLTPLR KSLNTFLFPA  180
TSSSTSYAPN SYGWGAFHLG FSGNTDPEPG RCRRTDGKKW RCSRDAVPDQ KYCERHINRG  240
RHRSRKPVEG QNGQANVSVP AKVGPVVSSS SSVPVSGSRT SX
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. microRNA396-GRF1/GRF3 regulatory module acts as a developmental regulator in the reprogramming of root cells during cyst nematode infection, leading to the formation of the syncytium. {ECO:0000269|PubMed:12974814, ECO:0000269|PubMed:15326298, ECO:0000269|PubMed:22419826, ECO:0000269|PubMed:22751317}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). Up-regulated in response to cyst nematode infection. {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165, ECO:0000269|PubMed:22419826}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023762284.10.0growth-regulating factor 1-like
SwissprotO810013e-63GRF1_ARATH; Growth-regulating factor 1
TrEMBLA0A2J6LH640.0A0A2J6LH64_LACSA; Uncharacterized protein
STRINGXP_006466427.11e-82(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.17e-62growth-regulating factor 1
Publications ? help Back to Top
  1. Casadevall R,Rodriguez RE,Debernardi JM,Palatnik JF,Casati P
    Repression of growth regulating factors by the microRNA396 inhibits cell proliferation by UV-B radiation in Arabidopsis leaves.
    Plant Cell, 2013. 25(9): p. 3570-83
    [PMID:24076976]
  2. Liu J,Rice JH,Chen N,Baum TJ,Hewezi T
    Synchronization of developmental processes and defense signaling by growth regulating transcription factors.
    PLoS ONE, 2014. 9(5): p. e98477
    [PMID:24875638]
  3. Cao Y,Han Y,Jin Q,Lin Y,Cai Y
    Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa).
    Front Plant Sci, 2016. 7: p. 1750
    [PMID:27933074]