PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28387 Da    PI: 9.5855
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58681748PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.31.5e-312473150
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
               krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  Lsa015945 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 73
               79***********************************************8 PP

2K-box108.57.8e-36951927100
      K-box   7 ksleeakaeslqqelakLkkeienLq....reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                 s++ea+a+ +qqe+akL+++i nLq    +  R+++Ge+L+++  k+L++Le++Lek++++iRskKnell+++ie++qk+e+el++ n+ Lr+k++e
  Lsa015945  95 GSVAEANAQFYQQEAAKLRQQIANLQnqnrQFYRNIMGESLGNMPAKDLKNLESKLEKGISRIRSKKNELLFSEIEYMQKRENELHNSNQFLRAKIAE 192
                45899*********************5433334789***********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-411675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.6691676IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-331788IPR002100Transcription factor, MADS-box
CDDcd002651.04E-451786No hitNo description
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-331838IPR002100Transcription factor, MADS-box
PfamPF003199.3E-272572IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-333853IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-335374IPR002100Transcription factor, MADS-box
PfamPF014862.4E-25100190IPR002487Transcription factor, K-box
PROSITE profilePS5129715.141102196IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSFPNDSGEM SPQRKLGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
IVFSSRGRLY EYANNSVKGT IDRYKKACLD PPSSGSVAEA NAQFYQQEAA KLRQQIANLQ  120
NQNRQFYRNI MGESLGNMPA KDLKNLESKL EKGISRIRSK KNELLFSEIE YMQKRENELH  180
NSNQFLRAKI AENERAQQQH MSLMPGSSDY DLVSPHQPFD GRNYLQVNDL QPNNNYSCQD  240
QTPLQLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-201684169MEF2C
5f28_B3e-201684169MEF2C
5f28_C3e-201684169MEF2C
5f28_D3e-201684169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023738865.10.0floral homeotic protein AGAMOUS-like isoform X1
RefseqXP_023738867.10.0floral homeotic protein AGAMOUS-like isoform X1
RefseqXP_023738868.10.0floral homeotic protein AGAMOUS-like isoform X2
SwissprotQ408721e-140AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLA0A2J6K4C10.0A0A2J6K4C1_LACSA; Uncharacterized protein
STRINGXP_010687169.11e-131(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-121MIKC_MADS family protein