PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015827
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25704.2 Da    PI: 5.757
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58687176PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF885.2e-28959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               k+i+n + rqvtfskRr g++KKAeELSvLCda+va++ifsstgkl+ yss
  Lsa015827  9 KKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVAIVIFSSTGKLFQYSS 59
               68***********************************************96 PP

2K-box53.11.3e-189217319100
      K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                 ++akL ke+ +   ++R+l Ge+L+ Ls++eL+qLe+ Le +l ++ +kK e+++++i++lq+k  el een +L+k+++e
  Lsa015827  92 ANYAKLSKEVAERTLQLRRLRGEELHLLSIEELHQLEKSLEAGLGRVVAKKGEVIMNEINRLQEKGTELMEENDRLKKEMME 173
                6799******9999999*************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.8E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.025161IPR002100Transcription factor, MADS-box
CDDcd002653.46E-39277No hitNo description
SuperFamilySSF554552.75E-31386IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.50887177IPR002487Transcription factor, K-box
PfamPF014868.9E-1692171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MAREKIQIKK IDNATARQVT FSKRRRGLFK KAEELSVLCD ADVAIVIFSS TGKLFQYSSS  60
SMKEILERHS LHSKNLQKLD QPSLELQLVE DANYAKLSKE VAERTLQLRR LRGEELHLLS  120
IEELHQLEKS LEAGLGRVVA KKGEVIMNEI NRLQEKGTEL MEENDRLKKE MMEISKVREQ  180
VHGDTENVIG EEGQSSESVT NISDSADPGQ DYESSYTSLK LGLPYPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-21170170MEF2C
5f28_B1e-21170170MEF2C
5f28_C1e-21170170MEF2C
5f28_D1e-21170170MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023770387.11e-164MADS-box protein JOINTLESS-like isoform X2
SwissprotQ9FUY61e-101JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLA0A2J6KZ991e-155A0A2J6KZ99_LACSA; Uncharacterized protein
STRINGcassava4.1_015543m1e-120(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-87MIKC_MADS family protein
Publications ? help Back to Top
  1. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]