PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 322aa    MW: 35052 Da    PI: 6.0821
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-37092PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.15.5e-30153206155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                +prl+Wtp+LH+rFv++v++L G ++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Lsa015620 153 RPRLVWTPQLHKRFVDVVAHL-GVKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 206
                59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.72E-19150210IPR009057Homeodomain-like
PROSITE profilePS5129411.41150209IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-30151211IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23154206IPR006447Myb domain, plants
PfamPF002491.5E-8156205IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGEEVRITDY DVGGEDDDRV LEWEAGLPNA DDLMPLSQSL VPVELASAFS ITPEPQRSMI  60
DVNRASQNTL SNLRGQTVKQ TLNKFNGFKS FGDDKGDEMV AEGDETADLT GDCSDSRKLR  120
RVDSGGTGAI GGAGEEADSA LRADDSSART SKRPRLVWTP QLHKRFVDVV AHLGVKNAVP  180
KTIMQLMNVE GLTRENVASH LQKYRLYLKR MQGLSNEGPS SSDHLFASTP VPQSLHESSG  240
GGNGNSHAPV PIPMPYPPQM VPMPYPPPQM VSHPGGAGGG AYHHGFDSHS HPYNMMMQQR  300
DWSGSKFASV SPYQHRMTPN DK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-21152211463ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283159.11e-125PREDICTED: transcription factor PCL1
RefseqXP_010650997.11e-125PREDICTED: transcription factor PCL1
RefseqXP_010650998.11e-125PREDICTED: transcription factor PCL1
SwissprotQ9SNB42e-85PCL1_ARATH; Transcription factor LUX
TrEMBLA0A118JWU00.0A0A118JWU0_CYNCS; Homeodomain-like protein
STRINGVIT_06s0004g05120.t011e-125(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.24e-78G2-like family protein