PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015562
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NF-YA
Protein Properties Length: 319aa    MW: 35925.2 Da    PI: 9.7446
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58689267PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-50855PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA97.21.8e-30162218158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                dep++VNaKQy++I++RR +Rak+e  +k+  k+rkpy+h+SRh hA+rRpRg+gGrF
  Lsa015562 162 DEPVFVNAKQYHGIIRRRRSRAKAEMANKV-LKNRKPYMHHSRHLHAMRRPRGNGGRF 218
                79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.7E-34160221IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.625161221IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.0E-26163218IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.3E-22164186IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860166186IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.3E-22195218IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDSVDYKEHE GLIPMSSVPW WSGLVTGSSL EESMKAKPSS IHNHTAFGSK FTPKRSDHDH  60
DADQVFDKRD TTRFNIFTGN VGGKLDQSAS DSDECNNSSN TQKPTKIQTS FSMESVPSDY  120
LRFGQPTMLC GKYRDQCYGV LSTYGHQIAG RIMLPLNLSN DDEPVFVNAK QYHGIIRRRR  180
SRAKAEMANK VLKNRKPYMH HSRHLHAMRR PRGNGGRFLN TKKENNCKDE NTDQEKDKNL  240
LKSPNYTIFM SNHHNFTSHR EPNNMFSTGD VKSLPIGNLS VVSFSEMMSG NTAPRHSFGM  300
HGKWVAATGG GDGRCNFTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-17162226266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023750237.10.0nuclear transcription factor Y subunit A-10-like isoform X1
RefseqXP_023750238.10.0nuclear transcription factor Y subunit A-10-like isoform X1
TrEMBLA0A2J6M7Y30.0A0A2J6M7Y3_LACSA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-42nuclear factor Y, subunit A10