PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015533
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 348aa    MW: 37161.1 Da    PI: 7.803
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-5514PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.14.6e-4275151177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +CqvegC+ dls+ak+y++rhkvC +hsk+++v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk++
  Lsa015533  75 RCQVEGCNLDLSDAKSYYSRHKVCGAHSKTAKVIVNGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKPS 151
                6**************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.2E-3569137IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.25773150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.72E-4074152IPR004333Transcription factor, SBP-box
PfamPF031102.6E-3276149IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MEMGGSSGSS ESQLLKIGLQ FGKEIYFEDV GVGAQVKSDD GLSPASGGDA AGGPQKKGRT  60
AGGVVSGFGQ QQPPRCQVEG CNLDLSDAKS YYSRHKVCGA HSKTAKVIVN GLEQRFCQQC  120
SRFHQLPEFD QGKRSCRRRL AGHNERRRKP SLLSTRYGTV SSSIFENNGN SGGFLMDFSS  180
CSRGRIQWPG TRAAPPPRAA IDLPIAGEKF PPLPWQSNLD NPPPYVPPGG CFNGVHEDSN  240
CALSLLSNHS SGSRNQSLSH EYYINPEAGA YVHQLHQPTT GTGAGSGTMV EVHYSTTATG  300
WVYETHDAHL GLGHVPQSGG GYSGEVGLGL HGGGRRYDSS VDHIDWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-31761491184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023730942.10.0squamosa promoter-binding-like protein 14 isoform X2
TrEMBLA0A2J6KM260.0A0A2J6KM26_LACSA; Uncharacterized protein
STRINGVIT_08s0007g06270.t014e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-49squamosa promoter binding protein-like 9