PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 281aa    MW: 30996.5 Da    PI: 10.2609
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58682025PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-4906PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.94.6e-412399278
               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
               C v+gC+adl +++eyhrrhkvCe hsk+p+v+++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Lsa015496 23 CLVDGCNADLGQCREYHRRHKVCELHSKSPKVTIAGREQRFCQQCSRFHSLAEFDEGKRSCRKRLDGHNRRRRKPQS 99
               **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.9922097IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.103.2E-332084IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3821102IPR004333Transcription factor, SBP-box
PfamPF031107.1E-312396IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEFSSSSKRA KTPAASNNIS VSCLVDGCNA DLGQCREYHR RHKVCELHSK SPKVTIAGRE  60
QRFCQQCSRF HSLAEFDEGK RSCRKRLDGH NRRRRKPQSD SISKTTATFL SSQPGMSRIL  120
SFNSTQIHLS SVVGSARTTG IRPDNHTIGP FNNQPPLNYL TRSLPTPSPH NGVGGDNHFN  180
FFQHRSLPLP VSSSQLNRGA GHSRALSLLS SSPPAHQTPA IMPPISSGIS QYGFAQLEMH  240
NETMLTESSG TTLQFQGMFN DDHGDSSSSG IKQQTLSFRW D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-2923961184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17996KRSCRKRLDGHNRRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023741824.10.0squamosa promoter-binding-like protein 13A
RefseqXP_023741825.10.0squamosa promoter-binding-like protein 13A
TrEMBLA0A2J6JY040.0A0A2J6JY04_LACSA; Uncharacterized protein
STRINGXP_009621034.12e-71(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.14e-44SBP family protein