PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 268aa    MW: 29952.9 Da    PI: 5.5133
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S32111321PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like67.52.2e-21223268146
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                k+r++W++eLH+rFv+a++qLGGs+ AtPk+i+el  v+gLt+++v
  Lsa015228 223 KQRRCWSTELHRRFVNALQQLGGSQAATPKQIRELYAVDGLTNDEV 268
                79*****************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.882220268IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-17220268IPR009057Homeodomain-like
SuperFamilySSF466891.97E-8220268IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-17223268IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEGCDQEAPM VECGSAVVKG IISDTTDKLF DNLFWKRLAA STNQFIYCFL LSAIITLKEE  60
TIVLKKSSNP EPVLEEFIPL QNTSGEDAKL EIISKEKCGG DKKNWLSTTQ LWNNPNPNPN  120
LNQIKPKFGN QNQFIKLPKR EXDEEDDGMI GDPYPTKAFI SYKGICGFTV VEEDKEESPI  180
PGLSLITLGI KNPVRGNLLL TKTISNSRLL PCSSPNAQQT SRKQRRCWST ELHRRFVNAL  240
QQLGGSQAAT PKQIRELYAV DGLTNDEV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284970.23e-49PREDICTED: uncharacterized protein LOC100267475 isoform X2
TrEMBLA0A118JUZ13e-79A0A118JUZ1_CYNCS; Homeodomain-like protein
STRINGVIT_03s0063g01060.t011e-48(Vitis vinifera)