PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family VOZ
Protein Properties Length: 473aa    MW: 52661 Da    PI: 5.3895
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58690510PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ406.55.4e-1251944171217
        VOZ   1 pppsaflgpkcalwdctrpaqg.......sewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                pppsaflgpkcalwdc+rpaqg       + w+ dycss+ha++a neg  g+tpv+rpkgi+lkd+llfaalsak+qgk+vg+pecegaatakspwna+
  Lsa015065 194 PPPSAFLGPKCALWDCPRPAQGwcsdrpvQGWFPDYCSSLHAAIAQNEGRFGMTPVIRPKGIELKDTLLFAALSAKTQGKDVGVPECEGAATAKSPWNAP 293
                89*******************955444434699******************************************************************* PP

        VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdek 193
                elfdls++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqv++e g lkrsyymdpqp++ +ewhlyeyei+++d +alyrlelklvd+k
  Lsa015065 294 ELFDLSVFEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVINESGWLKRSYYMDPQPMKFLEWHLYEYEISKCDVCALYRLELKLVDGK 393
                **************************************************************************************************** PP

        VOZ 194 ksakgkvskdsladlqkklgrlta 217
                ks+kgk+++dsladlqk++grlta
  Lsa015065 394 KSPKGKIANDSLADLQKQMGRLTA 417
                **********************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MGKGTKSKSG SHQIFKDRAK NRVEDLHGMF TDLQSARKES RSIDVAVLEE QVNQMLKEWK  60
NELNEPSPAS SLQQGASVGP YSPDISRLLQ LCDEEDDATS GLAAPKPDPD NGLQGFTVNH  120
TSQEQSFQLL DQCKGSPSGV NNTDITNQLD YFSFDLPHDF EQNFFTGIDG MGLCTRGEDT  180
SSPQITTFLP TLSPPPSAFL GPKCALWDCP RPAQGWCSDR PVQGWFPDYC SSLHAAIAQN  240
EGRFGMTPVI RPKGIELKDT LLFAALSAKT QGKDVGVPEC EGAATAKSPW NAPELFDLSV  300
FEGETIREWL FFDKPRRAFE SGNRKQRSLP DYNGRGWHES RKQVINESGW LKRSYYMDPQ  360
PMKFLEWHLY EYEISKCDVC ALYRLELKLV DGKKSPKGKI ANDSLADLQK QMGRLTAEFP  420
LDNSYNNKRS VKGRGKGNLK DKSGGATVYP MVASDDGAPF NYLVDDVGGY YLT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023746822.10.0transcription factor VOZ1
RefseqXP_023746823.10.0transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2J6JMA90.0A0A2J6JMA9_LACSA; Uncharacterized protein
STRINGVIT_10s0003g00500.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]