PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa015024
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 307aa    MW: 35765.4 Da    PI: 8.5732
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58681599PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-48582PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.45e-3067116150
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                krienk+nrqvtfskRrng+lKKA+ELSvLCdaev +iifss++klye+ 
  Lsa015024  67 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVGLIIFSSRDKLYEFG 116
                79**********************************************95 PP

2K-box102.27e-34138227998
      K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                ++e++++s++qe++kLk++ e+Lqr+qRhllGedL++Ls+keL++Le+qLe +l++ R++K+++++eq+eel++ke+el + nk L+ k+
  Lsa015024 138 NNERDTQSWYQEVSKLKAKFESLQRTQRHLLGEDLGPLSVKELHNLEKQLEGALTQARQRKTQIMVEQMEELRRKERELGDMNKHLKIKV 227
                678899********************************************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.46459119IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-4059118IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.19E-3260145IPR002100Transcription factor, MADS-box
CDDcd002651.51E-4160130No hitNo description
PRINTSPR004043.0E-316181IPR002100Transcription factor, MADS-box
PROSITE patternPS00350061115IPR002100Transcription factor, MADS-box
PfamPF003194.9E-2668115IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-318196IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-3196117IPR002100Transcription factor, MADS-box
PfamPF014861.1E-30138227IPR002487Transcription factor, K-box
PROSITE profilePS5129716.52143233IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSDVNQKPLN HIESTSNNFE TLRLYAFCTI SFSLFIQTHY RSPTCRENLE RETRESIVMG  60
RGRVELKRIE NKINRQVTFS KRRNGLLKKA YELSVLCDAE VGLIIFSSRD KLYEFGSVGV  120
MKTLERYQRC CFNPQDNNNE RDTQSWYQEV SKLKAKFESL QRTQRHLLGE DLGPLSVKEL  180
HNLEKQLEGA LTQARQRKTQ IMVEQMEELR RKERELGDMN KHLKIKVSHE LSSFDNEGQG  240
YRTQLQCPWN SPGNNTTFQM HPSQSNAMEI QQEPILQIGT YNQFVHGEGS SVQRNMIGES  300
SIHGWVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-2114522919103Developmental protein SEPALLATA 3
4ox0_B3e-2114522919103Developmental protein SEPALLATA 3
4ox0_C3e-2114522919103Developmental protein SEPALLATA 3
4ox0_D3e-2114522919103Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023732929.10.0MADS-box transcription factor 6-like
SwissprotQ8LLR11e-125MADS3_VITVI; Agamous-like MADS-box protein MADS3
TrEMBLA0A2J6MCQ00.0A0A2J6MCQ0_LACSA; Uncharacterized protein
STRINGXP_009796076.11e-132(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-101AGAMOUS-like 6
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]