PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa014565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Trihelix
Protein Properties Length: 707aa    MW: 79071.9 Da    PI: 7.1102
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-50751PU_refplantGDBView CDS
gnl|UG|Lsa#S58686540PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.16.8e-3062145186
   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                rW++qe+laL+++r++m+ ++r+++lk+plW+evs+k++e g++rs+k+Ckek+en+ k++k++keg+ ++   + +t+++fdql+
  Lsa014565  62 RWPRQETLALLKIRSDMDVAFRDSSLKGPLWDEVSRKLAELGYHRSAKKCKEKFENVYKYHKRTKEGRTSK--ADGKTYRFFDQLQ 145
                8********************************************************************96..66678******98 PP

2trihelix104.11e-32454539187
   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                rW+k e+ aLi++r+ ++++++++  k+plWee+s++m++ g++r++k+Ckekwen+nk+ykk+ke++kkr +e+s+tcpyf+ql+a
  Lsa014565 454 RWPKAEINALIKLRTTLDTKYQESGPKGPLWEEISSAMKKLGYNRNAKRCKEKWENINKYYKKVKESSKKR-PEDSKTCPYFHQLDA 539
                8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.88855119IPR017877Myb-like domain
SMARTSM007174.2E-459121IPR001005SANT/Myb domain
CDDcd122031.81E-2561126No hitNo description
PfamPF138372.1E-1961147No hitNo description
SMARTSM007176.5E-5451513IPR001005SANT/Myb domain
CDDcd122032.58E-29453518No hitNo description
Gene3DG3DSA:1.10.10.604.8E-4453510IPR009057Homeodomain-like
PROSITE profilePS500907.143453511IPR017877Myb-like domain
PfamPF138373.4E-23454540No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MLQGVSPGIG NSGEAAATAV SVQPNETAAA SAELASGGGG GGFSEDERGR IEEGGRNSGG  60
NRWPRQETLA LLKIRSDMDV AFRDSSLKGP LWDEVSRKLA ELGYHRSAKK CKEKFENVYK  120
YHKRTKEGRT SKADGKTYRF FDQLQALEAN PTAGSHHQQP LSLPPPQPVL SKPPPQVSTM  180
PNTSTITQIL PSVVTPVNIS VSHQNNVDPI SVAAPAVAMP SMNINHVGGF PFSQLNISAS  240
TNSSSSSTSS DDEPPERRRN RKRKWKEFFG RLMKEVIDKQ EELQSKFLDT LERRERDRMA  300
REEAWRIQEM AKMKREHDPL VQERSMVAAK DAAVITFLQK ITEQNPSTVI PQMPAMQLLQ  360
QQQQQNQPPP PLPPPSSVQP PPPMQQQHQQ QSQPPPPPPP QVLQQQQQPI SPLSAAVPLP  420
APVSLSTPAP PPPVVRNLDN GGGGENMLQP SPSRWPKAEI NALIKLRTTL DTKYQESGPK  480
GPLWEEISSA MKKLGYNRNA KRCKEKWENI NKYYKKVKES SKKRPEDSKT CPYFHQLDAI  540
YREKATSSNN NNNNNSNPAF AVKPENQMAP SWARPEQQWP LPAVVQEQHH HLQQQHHHHQ  600
QQQQQQQQQR HNQQMKTNES TGIEDHQHAD DDDDYDEEDE DDDEEEGEGE GEGGEYEIVP  660
NKTSSMAAVX MMEIYRQWKS NKHLGCTANV GHELQKMSDG FAGRVAG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1257263RRNRKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023742465.10.0trihelix transcription factor GT-2-like isoform X1
TrEMBLA0A2J6JWL00.0A0A2J6JWL0_LACSA; Uncharacterized protein
STRINGXP_009618661.11e-177(Nicotiana tomentosiformis)