PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa014428
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 306aa    MW: 34355.1 Da    PI: 9.0048
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58681184PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.85.5e-3328842128
        NAM  42 vePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                ++Pw+Lp+ ++ +ekew+f+++rdkky++g+r+nr+t+sgyWkatg d+ + + +++ +glkktLvfy+g+apkg +++W+m+eyrl
  Lsa014428   2 YDPWELPALAAIGEKEWFFYVPRDKKYRNGDRPNRVTTSGYWKATGADRMIRTDNSRSIGLKKTLVFYSGKAPKGIRSSWIMNEYRL 88 
                69*****8778899***********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.8861109IPR003441NAC domain
SuperFamilySSF1019413.53E-382109IPR003441NAC domain
PfamPF023651.4E-121788IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
XYDPWELPAL AAIGEKEWFF YVPRDKKYRN GDRPNRVTTS GYWKATGADR MIRTDNSRSI  60
GLKKTLVFYS GKAPKGIRSS WIMNEYRLPH HETERLQKAE ISLCRVYKRS GVEDHPSLPR  120
SLQTRSTSRT SNYHINQQSQ NSPSFNCFEG QSSHHTDEKP SDTTSPPPPA IVGTSLGLSN  180
PLNSSYNNVI ATPSSTIFPN SVDDLPRIIS SQRVLDTCPP SQLLNIHNYH LGDSSNYSPH  240
LFDNMLPQPQ QQQQLQPQLS SQALLALNNN LAGAGAGAVH VTFPERIWEW NSMLSEGSKD  300
LTAPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-38210957165NAC domain-containing protein 19
4dul_A7e-38210957165NAC domain-containing protein 19
1ut7_B7e-38210957165NO APICAL MERISTEM PROTEIN
1ut7_A7e-38210957165NO APICAL MERISTEM PROTEIN
1ut4_B7e-38210957165NO APICAL MERISTEM PROTEIN
1ut4_A7e-38210957165NO APICAL MERISTEM PROTEIN
3swp_D8e-38210960168NAC domain-containing protein 19
3swp_C8e-38210960168NAC domain-containing protein 19
3swp_B8e-38210960168NAC domain-containing protein 19
3swp_A8e-38210960168NAC domain-containing protein 19
3swm_D8e-38210960168NAC domain-containing protein 19
3swm_C8e-38210960168NAC domain-containing protein 19
3swm_B8e-38210960168NAC domain-containing protein 19
3swm_A8e-38210960168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002303230.15e-94hypothetical protein POPTR_0003s03670g
TrEMBLA0A118IN541e-135A0A118IN54_CYNCS; No apical meristem (NAM) protein
STRINGPOPTR_0003s03670.12e-93(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-74NAC domain containing protein 35