PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa014343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 499aa    MW: 56381.5 Da    PI: 4.3894
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-19288PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.12e-54141411128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv +yL++k+ gk++++ ++i++vd+ykvePwdLp  +k+k+++ ewyfFs  dkky +g+r+nrat++gyWk+tgkd+ v++ +++
  Lsa014343  14 LAPGFRFHPTDEELVRYYLRRKICGKPFRF-DAISDVDVYKVEPWDLPdlSKLKSRDLEWYFFSALDKKYGNGSRTNRATEKGYWKTTGKDRVVHH-RSQ 111
                579**************************9.99**************96448888888************************************99.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vg+kktLv+++grapkge+t+Wvmheyrl
  Lsa014343 112 QVGMKKTLVYHSGRAPKGERTNWVMHEYRL 141
                ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-6311164IPR003441NAC domain
PROSITE profilePS5100558.52214164IPR003441NAC domain
PfamPF023653.6E-2816141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MALSIDSTPV ASSLAPGFRF HPTDEELVRY YLRRKICGKP FRFDAISDVD VYKVEPWDLP  60
DLSKLKSRDL EWYFFSALDK KYGNGSRTNR ATEKGYWKTT GKDRVVHHRS QQVGMKKTLV  120
YHSGRAPKGE RTNWVMHEYR LIDQELEKAG IIQDAFVLCR IFRKSGSGPK NGEKYGAPFI  180
EEEWEDEDES VVVPKQEDCT QELPVDEDSY LDANDIEQIL NTDMPVEDVP LPLNFNQDDY  240
SNIISNSDES NKSFDPPVQT VFHEHVEEQS NPMNFDIDYL LDQPYFDATS DFPLDETLFF  300
EANDLKDDVN TDSGLDILDE YMSFYNSDLD NFQPTFDSLQ NDNIALDSSS VLKGTHQEQN  360
NDKDIASSSK KEHADQETDI AYPFLKKASY MLENISAPPA FASEFPAKYM ASGSHGQSSV  420
NVTSGMIHIS NVSFGSGAMD FSLGKNTQLN IVVSFGDMNT GKVNSGGSRS WFYCGLLWIL  480
VASLSFKIGS LVCSRSFMS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-501317019174NAC domain-containing protein 19
3swp_C1e-501317019174NAC domain-containing protein 19
3swp_B1e-501317019174NAC domain-containing protein 19
3swp_A1e-501317019174NAC domain-containing protein 19
3swm_D1e-501317019174NAC domain-containing protein 19
3swm_C1e-501317019174NAC domain-containing protein 19
3swm_B1e-501317019174NAC domain-containing protein 19
3swm_A1e-501317019174NAC domain-containing protein 19
4dul_B1e-501317016171NAC domain-containing protein 19
4dul_A1e-501317016171NAC domain-containing protein 19
1ut7_B1e-501317016171NO APICAL MERISTEM PROTEIN
1ut7_A1e-501317016171NO APICAL MERISTEM PROTEIN
1ut4_B1e-501317016171NO APICAL MERISTEM PROTEIN
1ut4_A1e-501317016171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015582995.11e-172PREDICTED: NAC domain-containing protein 53
SwissprotQ949N01e-140NAC53_ARATH; NAC domain-containing protein 53
TrEMBLA0A103YID60.0A0A103YID6_CYNCS; No apical meristem (NAM) protein
STRINGPGSC0003DMT4000600901e-168(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.11e-133NAC domain containing protein 53