PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa014061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 215aa    MW: 24411.9 Da    PI: 8.7575
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58675922PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.12.3e-281059251
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               ri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsst+klye+ss
  Lsa014061 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTNKLYEFSS 59
               8***********************************************96 PP

2K-box77.73.1e-26781728100
      K-box   8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                +  ++ ++ + +q e+a Lk++++nL + +R+l+Ge+L  L +++Lq+Le+qLe sl+ iR kK+e+l+++ie+l +k  +++++n +L kk+ e
  Lsa014061  78 QlvNSMSDVKFCQMEVAILKQQLQNLHEAHRQLMGEELCGLGVEDLQKLENQLEISLQGIRMKKEEILTNEIEDLTRKGSQIHQQNIELYKKIHE 172
                2446788899**********************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.637161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.05E-31276IPR002100Transcription factor, MADS-box
CDDcd002659.71E-43274No hitNo description
PRINTSPR004043.9E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-283859IPR002100Transcription factor, MADS-box
PfamPF014862.6E-2385170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.26486176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGRGKIAIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TNKLYEFSSA  60
SMKSVIQRYN KSKEENSQLV NSMSDVKFCQ MEVAILKQQL QNLHEAHRQL MGEELCGLGV  120
EDLQKLENQL EISLQGIRMK KEEILTNEIE DLTRKGSQIH QQNIELYKKI HEARAYAANY  180
DEYSSMHETP LLSKHVAPPI SSYANLSIGG VFTYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-22182182MEF2C
5f28_B6e-22182182MEF2C
5f28_C6e-22182182MEF2C
5f28_D6e-22182182MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023754290.11e-158MADS-box transcription factor 23-like
SwissprotQ6EP494e-82MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A2J6LZH61e-157A0A2J6LZH6_LACSA; Uncharacterized protein
STRINGXP_006472406.14e-89(Citrus sinensis)
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]