PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa013041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 24766.4 Da    PI: 10.1002
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58676623PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.92.4e-27959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien +nrqvtfskRr g+lKKA ELS+LCdaeva+++fs++gk y +ss
  Lsa013041  9 KRIENPTNRQVTFSKRRDGLLKKAIELSILCDAEVALLVFSPSGKAYHFSS 59
               79***********************************************96 PP

2K-box74.72.6e-258417212100
      K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                ++ e +++e++ +kk ie L+++++hl GedL+sL +keL+qLe+qL  ++ ++RskK +ll e+i+ l++  k lqee++ L+kkl e
  Lsa013041  84 RTIEVWKNEMDEMKKTIEILETKHKHLAGEDLSSLGIKELKQLERQLRIGVDRVRSKKWRLLSEHISLLKRNHKTLQEEHTILQKKLHE 172
                56789*********************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.693161IPR002100Transcription factor, MADS-box
CDDcd002654.01E-41277No hitNo description
SuperFamilySSF554551.07E-32290IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.61386176IPR002487Transcription factor, K-box
PfamPF014861.5E-2286170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MGRGKVELKR IENPTNRQVT FSKRRDGLLK KAIELSILCD AEVALLVFSP SGKAYHFSSH  60
DMDMTIRRYR NEKGLHKMNN HGVRTIEVWK NEMDEMKKTI EILETKHKHL AGEDLSSLGI  120
KELKQLERQL RIGVDRVRSK KWRLLSEHIS LLKRNHKTLQ EEHTILQKKL HELLNEADEY  180
SGLDSSDHAI QRFIPDGQSH SPLNMNQLGF SNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A6e-21169169MEF2 CHIMERA
6byy_B6e-21169169MEF2 CHIMERA
6byy_C6e-21169169MEF2 CHIMERA
6byy_D6e-21169169MEF2 CHIMERA
6bz1_A6e-21169169MEF2 CHIMERA
6bz1_B6e-21169169MEF2 CHIMERA
6bz1_C6e-21169169MEF2 CHIMERA
6bz1_D6e-21169169MEF2 CHIMERA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023747202.11e-156truncated transcription factor CAULIFLOWER D-like
TrEMBLA0A2J6JLD41e-155A0A2J6JLD4_LACSA; Uncharacterized protein
STRINGMigut.D01274.1.p6e-84(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.16e-46AGAMOUS-like 16