PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa012891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Trihelix
Protein Properties Length: 249aa    MW: 28214.9 Da    PI: 5.1296
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S32119482PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix42.22e-131995281
   trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81
               Wt +e l L++ ++ +e + +++ +  ++W+ + +++ + g++r+ +qC+ kw++l  +ykkik++ +k+ s +s    +
  Lsa012891 19 WTVEESLILVNEVSAVEADCGDTLASFQKWKIIVENCNALGVNRNLNQCRRKWDSLLSDYKKIKQSGSKKVSFNS---EL 95
               *****************************************************************9998754444...44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-51577IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-51777IPR009057Homeodomain-like
PfamPF138374.5E-121797No hitNo description
PROSITE profilePS500907.3291975IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MEHDGVGALR TRSKVAPDWT VEESLILVNE VSAVEADCGD TLASFQKWKI IVENCNALGV  60
NRNLNQCRRK WDSLLSDYKK IKQSGSKKVS FNSELFKVIE WYVRDYEGGY DTDPDSDPEA  120
LPEPVLASFP QSASKKQRSK IIPQKRTIEE TPKPKKPIKT EERKVEEYSS IPTNNTLNII  180
SRPKEINHED QEQIMAENLR ENAELIEAIV KQDLINGGSN EELTRVNGDK LIVCLSNLVV  240
ALDRLSKFV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023749251.10.0trihelix transcription factor ASR3-like
TrEMBLA0A2J6JGU51e-180A0A2J6JGU5_LACSA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.11e-43sequence-specific DNA binding transcription factors