PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa012697
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Trihelix
Protein Properties Length: 525aa    MW: 58727.2 Da    PI: 9.9225
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58689202PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.68.1e-2958141287
   trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                W+++e+laLie+r++m+ ++r++++k+plW+evs+k+ e g++rs k+Ckek+en+ k++k++keg+ ++   + +t+++fdqlea
  Lsa012697  58 WPRKETLALIEIRSKMDFAFRDASAKGPLWDEVSRKLGELGYHRSGKKCKEKFENVYKYHKRTKEGRTSK--ADGKTYRFFDQLEA 141
                ********************************************************************96..66678*******85 PP

2trihelix102.14.3e-32395480187
   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                rW+k ev aLi++r+ ++ +++++  k+plWee+s+ m + g++r++k+Ckekwen+nk+ykk+ke++kkr +e+s+tcpyf+ql+a
  Lsa012697 395 RWPKTEVYALIKLRTTLDMKYQDSGPKGPLWEEISAGMIKLGYNRNAKRCKEKWENINKYYKKVKESSKKR-PEDSKTCPYFHQLDA 480
                8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.10850114IPR017877Myb-like domain
SMARTSM007177.0E-454116IPR001005SANT/Myb domain
PfamPF138371.0E-1757142No hitNo description
CDDcd122032.99E-2258121No hitNo description
SMARTSM007170.0054392454IPR001005SANT/Myb domain
CDDcd122034.82E-28394459No hitNo description
PROSITE profilePS500907.004394452IPR017877Myb-like domain
PfamPF138372.3E-22395481No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MLQGPPGLIG NSGDVATPAQ PPQQPVQAHG SVAVELGGGF SEEETGGRIE GERSGNGWPR  60
KETLALIEIR SKMDFAFRDA SAKGPLWDEV SRKLGELGYH RSGKKCKEKF ENVYKYHKRT  120
KEGRTSKADG KTYRFFDQLE ALEANTQRPP AGMTTTTTAQ HPFSQPSVVI PFNVTGSHSH  180
QTNVSPISVA APAMVNHGGT GASAGAFPFS SSNTTSSSTS SDEEPPELRR KRKRKWKDFF  240
GRLMTEVIHK QEELQMKFLD QIERRERDRM AREEAWRIEE MAKMNREHEL LVQERSIAAA  300
KDAAVITFLQ KITEQNSNNP VTQISQQPPP QPQKQQNLQP LQTPPPPPPQ TPTPPPAQQQ  360
HQVQPPVLPA APVVKNVENG GGGNSNIILA PSPSRWPKTE VYALIKLRTT LDMKYQDSGP  420
KGPLWEEISA GMIKLGYNRN AKRCKEKWEN INKYYKKVKE SSKKRPEDSK TCPYFHQLDA  480
IYRERANNSS HSSLRLPETT QMEPIMAEPE QQWPLPAAGV QQQKP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1228233RRKRKR
2228234RRKRKRK
3229234RKRKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023770820.10.0trihelix transcription factor GT-2-like
SwissprotQ391171e-132TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A2J6KY700.0A0A2J6KY70_LACSA; Uncharacterized protein
STRINGSolyc12g056510.1.11e-158(Solanum lycopersicum)
STRINGXP_009618661.11e-158(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-53Trihelix family protein