PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa012539
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 305aa    MW: 34254.1 Da    PI: 6.1906
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58682451PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.7e-322074155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprl+Wt+eLH+rFv+ v+qLGG+ekAtPk+++++m+++gLtl+h+kSHLQkYRl
  Lsa012539 20 KPRLKWTSELHQRFVDSVSQLGGPEKATPKSLMRVMGIHGLTLYHLKSHLQKYRL 74
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.8821777IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-291874IPR009057Homeodomain-like
SuperFamilySSF466891.13E-141974IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-222075IPR006447Myb domain, plants
PfamPF002491.4E-62273IPR001005SANT/Myb domain
PfamPF143796.1E-24117162IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MAHENIQNQE VNLVLSSDAK PRLKWTSELH QRFVDSVSQL GGPEKATPKS LMRVMGIHGL  60
TLYHLKSHLQ KYRLGKIQQS PACSGNIQEE FGDDHRSDIT SIDHNDENPN QISESLKIAE  120
ALQMQMEVQR KLHEQIEVQR HLQLRIEAQG KYLQSVLRKA QDTLAGYNSS AIEVEAAKAE  180
LSHLVSMVDN GCPSSLSMLT EVEDSRLKKE VKKTRNGSSM ESSLTSSESW GRKENDDLDL  240
KLMDRNGMGD SGNGRKRSGS TISDGNCQGK RLQKGSERFD LNSQYVNDFD FDFESKSSTL  300
DLNSE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339891.11e-104PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ9SAK54e-56APL_ARATH; Myb family transcription factor APL
TrEMBLF6HPQ81e-100F6HPQ8_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g02550.t011e-100(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.12e-77G2-like family protein