PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa011551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 238aa    MW: 27821.7 Da    PI: 8.4753
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-49484PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.45.1e-30959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+nrqvtfskRr g+lKKA+E+SvLCda+va+i+fs++gkl eys+
  Lsa011551  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSTKGKLCEYST 59
               79***********************************************96 PP

2K-box107.61.4e-35751741100
      K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                y++ + + ++++++ s++ e+akLk++ie Lq++qRh++GedL+sLslkeLq+LeqqL+++lk++R +Kn+l+le+i+elqkk kelq++n++L+k+++e
  Lsa011551  75 YAEMQANTTHNETQGSWSLEHAKLKARIELLQKTQRHFMGEDLDSLSLKELQNLEQQLDTALKHVRLRKNQLMLESISELQKKDKELQDQNNTLSKQIKE 174
                56678888899999***********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.95161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-33288IPR002100Transcription factor, MADS-box
CDDcd002654.14E-39276No hitNo description
PRINTSPR004042.8E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-293859IPR002100Transcription factor, MADS-box
PfamPF014865.3E-2983172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.85888178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGRGRVTLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD ADVALIVFST KGKLCEYSTD  60
SGMERILERY ERYSYAEMQA NTTHNETQGS WSLEHAKLKA RIELLQKTQR HFMGEDLDSL  120
SLKELQNLEQ QLDTALKHVR LRKNQLMLES ISELQKKDKE LQDQNNTLSK QIKELEKDIP  180
SHQQQNNETM PSFQFNIFNN PNMCEQPRME GDAEENLRQA QMATVTVMPP WMIQHMNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-19174173Myocyte-specific enhancer factor 2B
1tqe_Q3e-19174173Myocyte-specific enhancer factor 2B
1tqe_R3e-19174173Myocyte-specific enhancer factor 2B
1tqe_S3e-19174173Myocyte-specific enhancer factor 2B
6bz1_A4e-19187187MEF2 CHIMERA
6bz1_B4e-19187187MEF2 CHIMERA
6bz1_C4e-19187187MEF2 CHIMERA
6bz1_D4e-19187187MEF2 CHIMERA
6c9l_A3e-19174173Myocyte-specific enhancer factor 2B
6c9l_B3e-19174173Myocyte-specific enhancer factor 2B
6c9l_C3e-19174173Myocyte-specific enhancer factor 2B
6c9l_D3e-19174173Myocyte-specific enhancer factor 2B
6c9l_E3e-19174173Myocyte-specific enhancer factor 2B
6c9l_F3e-19174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023764284.11e-179truncated transcription factor CAULIFLOWER A-like isoform X2
SwissprotQ6E6S71e-101AP1_VITVI; Agamous-like MADS-box protein AP1
TrEMBLA0A2J6LCT81e-177A0A2J6LCT8_LACSA; Uncharacterized protein
STRINGXP_009625854.11e-109(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.18e-92MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]