PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa011297
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family TCP
Protein Properties Length: 298aa    MW: 31897.1 Da    PI: 10.4771
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58689473PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-42611PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP116.73.1e-3652123273
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                ++++++++++hTkv+gR+RR+R++a+ca r+F+L++eLG+++d++ti+WLlq a+p+i+++tgt++++a ++
  Lsa011297  52 PPRRSSTKDRHTKVEGRGRRIRMPATCATRIFQLTKELGHKSDGETIQWLLQHAEPSIIAATGTGTIPAIAM 123
                7899************************************************************99998444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.1E-3057146IPR005333Transcription factor, TCP
PROSITE profilePS5136925.7758112IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MNSPSPPSAA HQPPSPPNPP QTAASSHGLS LIPLKKEPLL EEKVFTTPPP PPPRRSSTKD  60
RHTKVEGRGR RIRMPATCAT RIFQLTKELG HKSDGETIQW LLQHAEPSII AATGTGTIPA  120
IAMSVNGTLK IPTSISTVTV TATAAAVATT TTSIPKKRKL PSDFDINRNE NTPTTVTTSV  180
LAPLMTTTAQ PQSFIPIWAI PYNGTAAFWA FQPSTTPFLN NSATPISFIT SGDQKPTPIN  240
TANYTTITTT STSISTSTSA SATTTPTKAQ SFTDFPMNLH ERKEFSFIQV NHGTPSEQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023764346.10.0transcription factor TCP9-like
SwissprotO646471e-52TCP9_ARATH; Transcription factor TCP9
TrEMBLA0A2J6LCJ80.0A0A2J6LCJ8_LACSA; Uncharacterized protein
STRINGVIT_15s0048g01150.t014e-63(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-37TCP family protein