PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa011065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 374aa    MW: 43092.2 Da    PI: 6.1543
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58685977PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.41.4e-49131411128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi+evd++k+ePwd++ k++     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk v+s + 
  Lsa011065  13 VPPGFRFHPTEEELLHYYLRKKVAYEKIDL-DVIREVDLNKLEPWDIQDKCNIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVVHS-SL 110
                69****************************.9***************954443122456**********************************9999.89 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                + +g++ktLvfykgrap+g+k+d +mheyrl
  Lsa011065 111 RRIGMRKTLVFYKGRAPHGQKSDYIMHEYRL 141
                99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-559173IPR003441NAC domain
PROSITE profilePS5100553.39113173IPR003441NAC domain
PfamPF023654.2E-2614141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MDLSVNVNGQ SKVPPGFRFH PTEEELLHYY LRKKVAYEKI DLDVIREVDL NKLEPWDIQD  60
KCNIGSTPQN DWYFFSHKDK KYPTGTRTNR ATAAGFWKAT GRDKVVHSSL RRIGMRKTLV  120
FYKGRAPHGQ KSDYIMHEYR LDDNIITTQD SSASNMSDYT HEEGWVVCRV FKKKNYHKSL  180
ESPHRSLPDS MDTRAQLQLL NKDDVLEQLL VYMDSRSCKQ EIENFTTTQF VNPMFLHLPR  240
LASSTQLTTS PPESSATFDQ GSSLKTYDSM SDLLAEAEHS RNIHTKMMED HECISNWADL  300
DKFVASQLNG QMEESKQLYS CYGSESNDEK LDFSVDKDEQ DVSARRNVAS CNSELDIWSL  360
TRPSSLDPLC HLSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-481317515170Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039366.11e-143NAC domain-containing protein, putative
SwissprotQ84WP61e-118NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A124SB281e-178A0A124SB28_CYNCS; No apical meristem (NAM) protein
STRINGVIT_02s0025g02710.t011e-139(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-109NAC family protein