PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa011038
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 177aa    MW: 20442.3 Da    PI: 6.5198
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S29953309PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-3096PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.52.3e-25959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienks r+vtfskRr+g++KKA  LS LCda+va+i+fs  gkly ++s
  Lsa011038  9 KRIENKSSRSVTFSKRRTGLIKKARHLSLLCDADVALIVFSAPGKLYQFCS 59
               79***********************************************96 PP

2K-box27.81e-10981582282
      K-box  22 akLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk 82 
                +k +   e Lq+  R +  ++ e+Lsl ++ qLe++L+++l + Rs+K++l ++ i++lq+
  Lsa011038  98 TKFRTCKELLQEVDRLVEENNTEELSLTDMTQLEEELHDALVQTRSRKTQLKMDYISTLQE 158
                56666677788888888888899************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.45161IPR002100Transcription factor, MADS-box
CDDcd002653.05E-34277No hitNo description
SuperFamilySSF554559.55E-27273IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512976.99490177IPR002487Transcription factor, K-box
PfamPF014868.6E-798159IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRRKLEIKR IENKSSRSVT FSKRRTGLIK KARHLSLLCD ADVALIVFSA PGKLYQFCSS  60
ASNSMAHLLA TYEKSRLEPE SGTIEGDDQD LELPLQCTKF RTCKELLQEV DRLVEENNTE  120
ELSLTDMTQL EEELHDALVQ TRSRKTQLKM DYISTLQEEV SFNIDFFKEK FKYPSHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-17183180MEF2C
5f28_B4e-17183180MEF2C
5f28_C4e-17183180MEF2C
5f28_D4e-17183180MEF2C
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023751297.11e-112MADS-box protein FLOWERING LOCUS C-like isoform X1
TrEMBLA0A2J6M5X21e-108A0A2J6M5X2_LACSA; Uncharacterized protein
STRINGXP_010682731.17e-43(Beta vulgaris)