PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010629
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 346aa    MW: 40037.7 Da    PI: 6.746
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58687314PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.87.9e-3163116255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                prlrWt++LH rFv+a+e+LGG+e+AtPk +l+lm++kgL ++hvkSHLQ+YR+
  Lsa010629  63 PRLRWTNDLHLRFVQAIEKLGGQERATPKLVLQLMNIKGLHIAHVKSHLQMYRS 116
                8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.99459119IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-2959117IPR009057Homeodomain-like
SuperFamilySSF466898.78E-1461117IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-2363118IPR006447Myb domain, plants
PfamPF002491.2E-764115IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MERSQETKCS KTSSDSYPNE EGEEESESKE VLELKDGGSS SNSTIEESDK KPSVRPYVRS  60
KMPRLRWTND LHLRFVQAIE KLGGQERATP KLVLQLMNIK GLHIAHVKSH LQMYRSKKIE  120
DPNQVANPRI EDGDRNIFNL SQLPMLQCYN RTYDSAFRYE DPPPYRRDWM HNALREHCSF  180
QKTKPRFYNI ADRILAINHV EQANRSMQSN LQPPLNEKFS WEVNDNFGSR ICEKMDMLPN  240
PNEKLNPFKI QEHQNISLDL ESTSLEKHKG TKRKASDLSL DLNLSLGVHS EKGVEEGDDD  300
GEGEERNLSL SLYSPYFSRN RKKLITEDDH SNDQKAKRAS TLDLTI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095220.11e-76PREDICTED: uncharacterized protein LOC105174731
TrEMBLA0A118K6Z31e-163A0A118K6Z3_CYNCS; Homeodomain-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-54G2-like family protein