PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010115
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 152aa    MW: 18039 Da    PI: 6.9596
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58671943PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.78.9e-5771361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPtdeelv++yL+kk+++++++l +vi+++d+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s k+
  Lsa010115   7 VPPGFRFHPTDEELVDYYLRKKINSRRIDL-DVIRDIDLYKIEPWDLQElcSLGTeEQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIYS-KQ 104
                69****************************.9***************954533332566**************************************.89 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                 lvg++ktLvfykgrap+g+k+dW+mheyrle
  Lsa010115 105 DLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                9*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.27E-585151IPR003441NAC domain
PROSITE profilePS5100556.6687152IPR003441NAC domain
PfamPF023658.8E-308135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKIN SRRIDLDVIR DIDLYKIEPW DLQELCSLGT  60
EEQNEWYFFS HKDKKYPTGT RTNRATTAGF WKATGRDKAI YSKQDLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN ATTTQEEGWV VX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-50613514140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234394.11e-104PREDICTED: NAC domain-containing protein 7-like isoform X1
SwissprotQ9FWX26e-97NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A103YDR11e-106A0A103YDR1_CYNCS; No apical meristem (NAM) protein
STRINGPOPTR_0012s14660.11e-100(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.15e-78NAC 007