PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family VOZ
Protein Properties Length: 302aa    MW: 33054.9 Da    PI: 4.7531
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58680187PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ220.93.2e-681793011125
        VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsl 100
                pppsaflgpkc+lwdc+rpaqg  w+ dycss+ha++a  eg pg++pv+rpkgi+lkd+llfaal+ak qgk+vg+pec+gaatakspwna++lfd+++
  Lsa009834 179 PPPSAFLGPKCSLWDCPRPAQG--WCPDYCSSLHAAVAQTEGCPGMKPVIRPKGIELKDNLLFAALTAKSQGKNVGVPECQGAATAKSPWNAPDLFDIAV 276
                89*******************9..9*************************************************************************** PP

        VOZ 101 legetirewlffdkprrafesgnrk 125
                +ege +rewlffdkprrafesgnrk
  Lsa009834 277 FEGEMVREWLFFDKPRRAFESGNRK 301
                ************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGKGTKGKSG SHQILKDRAK NRVEDLHGMF TDLQSARKES RGIDVAVLEE QVNQMLKEWK  60
NELNEPSPAS SLQQGASFGL SSPDISKLLQ LCEEEDDATS GLAPPKPDPD ALETGENAAF  120
HKKEQESKST GQSKGSPSGI EIERELDYFS FDDNNNNIII QEGNDDLLPM MSFLPNISPP  180
PSAFLGPKCS LWDCPRPAQG WCPDYCSSLH AAVAQTEGCP GMKPVIRPKG IELKDNLLFA  240
ALTAKSQGKN VGVPECQGAA TAKSPWNAPD LFDIAVFEGE MVREWLFFDK PRRAFESGNR  300
KX
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023764032.10.0transcription factor VOZ1-like isoform X1
RefseqXP_023764033.10.0transcription factor VOZ1-like isoform X1
RefseqXP_023764034.10.0transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ01e-119VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2J6LDB60.0A0A2J6LDB6_LACSA; Uncharacterized protein
STRINGcassava4.1_006671m1e-133(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-120vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]