PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009128
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NF-YA
Protein Properties Length: 295aa    MW: 32893.9 Da    PI: 6.8014
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-49493PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.59e-33126182158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh+hA+rR RgsgGrF
  Lsa009128 126 QEPVYVNAKQYHAILRRRQSRAKAELEKKL-IKDRKPYLHESRHQHAMRRVRGSGGRF 182
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.6E-36124185IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.239125185IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.9E-28127182IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.1E-25128150IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860130150IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.1E-25159182IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MRENSSDSSS QEQSQDKESQ SEEVLSEEED DVSKETQNAQ SFPSDSYGQE QHNYHQGVPN  60
VLPSNPETLG QVPQLELVGH SIACAPNPYC DPYYSGMMAA YGQPMVHPQF LDMHQARMPL  120
PLEMAQEPVY VNAKQYHAIL RRRQSRAKAE LEKKLIKDRK PYLHESRHQH AMRRVRGSGG  180
RFAKKTQVDS SSKHGGDEDN NNNNNNTTGS GSGMSSSQSV NVNMNSTGMK RVRSNESDES  240
LEAHNEKRRG ELVNSLNARS TYQLHSSDRG DGGSLGQQWI SISSNQASQR AVAMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-21126190266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023751500.10.0nuclear transcription factor Y subunit A-1-like
SwissprotQ9LXV51e-58NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A2J6M5740.0A0A2J6M574_LACSA; Uncharacterized protein
STRINGXP_006470619.13e-84(Citrus sinensis)
STRINGXP_006446125.13e-84(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.47e-56nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Siriwardana CL, et al.
    NUCLEAR FACTOR Y, Subunit A (NF-YA) Proteins Positively Regulate Flowering and Act Through FLOWERING LOCUS T.
    PLoS Genet., 2016. 12(12): p. e1006496
    [PMID:27977687]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]