PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NF-YA
Protein Properties Length: 264aa    MW: 29866.9 Da    PI: 6.652
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58685201PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-38837PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.34.5e-32121177158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh+hA+rR R+sgGrF
  Lsa008910 121 QEPVYVNAKQYHAILRRRQSRAKAELEKKL-IKDRKPYLHESRHQHAMRRVRSSGGRF 177
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.7E-35119180IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.37120180IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.2E-27122177IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.6E-24123145IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860125145IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.6E-24154177IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MRANSHDSSS QEQSLDRDTQ SDEVLSEEED DVSKETHNNV SYFPSDTCAQ EHQNFQHDIL  60
PRNEETLSQP PQLELVNQSV APYYDPYYGG MMAAAYGQHF VHPQFVDVQQ VRMPLPLEMA  120
QEPVYVNAKQ YHAILRRRQS RAKAELEKKL IKDRKPYLHE SRHQHAMRRV RSSGGRFAKK  180
TETDALKNTS DDVATGMKRV HSEPAVSFGT HTNQETRGGG MVNSCNGGAL RYENQDGFQE  240
GGSLGQQWST IPSSQNSQRA VAMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-20121185266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023729786.10.0nuclear transcription factor Y subunit A-9-like
TrEMBLA0A2J6KPJ90.0A0A2J6KPJ9_LACSA; Uncharacterized protein
STRINGXP_006470619.11e-67(Citrus sinensis)
STRINGVIT_06s0004g02270.t011e-67(Vitis vinifera)
STRINGXP_006446125.11e-67(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.12e-54nuclear factor Y, subunit A9