PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008673
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 414aa    MW: 46485.7 Da    PI: 7.3138
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58695154PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-50756PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.52.6e-40169246178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC+ dls+ k+yhrrh++C  hsk+p+v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL+ hn+rrr++q+
  Lsa008673 169 RCQVEGCNLDLSSSKDYHRRHRICANHSKSPKVIVAGMERRFCQQCSRFHDLSEFDDRKRSCRRRLSAHNARRRRPQS 246
                6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-34164231IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.453167244IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.19E-37168249IPR004333Transcription factor, SBP-box
PfamPF031101.3E-31170243IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MELLAISILL VRFVSLMDWN LNTPSEWDWE NLAMYSSKEI EVAKNLQFSS HESQENVVVD  60
NVDFSFSASA DSSSKETIKS TFRGFDDLPR DFLDKDDSSW IGENGSFSNM VEEASVLSGE  120
AMIGLKLGRH ASTSISSSKM ATTSVSLFPT SSPMIKRSRA SYLSSQSPRC QVEGCNLDLS  180
SSKDYHRRHR ICANHSKSPK VIVAGMERRF CQQCSRFHDL SEFDDRKRSC RRRLSAHNAR  240
RRRPQSEEIQ FSSTRLSSSM SSDRRPQMNF LLNRASIPRR DSAPPESSCD FKGEESFLGL  300
AKGGGVDVLP PNGALHFGSE RFMPRSMSHN GIDATPNSML SGDVRHAFSL LSTSSWPSNW  360
PEEASSFDQF GQSNSISLSQ PGMPLELQNT TNTTQLQTFH SFRSPRELER FYSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-261702431184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225242RKRSCRRRLSAHNARRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023732390.10.0squamosa promoter-binding-like protein 3
TrEMBLA0A103YMM50.0A0A103YMM5_CYNCS; Transcription factor, SBP-box (Fragment)
STRINGVIT_11s0065g00170.t013e-93(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.45e-36squamosa promoter binding protein-like 10