PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 601aa    MW: 67380.3 Da    PI: 4.3012
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58693776PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.71.1e-53181451128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv +yL++k+ gk++++ ++i++vd+ykvePwdLp  +++k+++ ewyfFs  dkky +g+r+nrat++gyWk+tgkd++v++ +++
  Lsa008320  18 LAPGFRFHPTDEELVRYYLRRKICGKPFRF-DAISDVDVYKVEPWDLPglSRLKSRDLEWYFFSVLDKKYGNGSRTNRATDKGYWKTTGKDRSVYH-RSQ 115
                579**************************9.99***************6448888999**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                lvg+kktLv++ grapkge+t+Wvmheyrl
  Lsa008320 116 LVGMKKTLVYHIGRAPKGERTNWVMHEYRL 145
                ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-6411168IPR003441NAC domain
PROSITE profilePS5100558.91918168IPR003441NAC domain
PfamPF023652.5E-2720145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MAVVLDSVTP APTTASSLAP GFRFHPTDEE LVRYYLRRKI CGKPFRFDAI SDVDVYKVEP  60
WDLPGLSRLK SRDLEWYFFS VLDKKYGNGS RTNRATDKGY WKTTGKDRSV YHRSQLVGMK  120
KTLVYHIGRA PKGERTNWVM HEYRLIDQEL EKAGIIQDSF VLCRIFRKSG SGPKNGEQYG  180
APFVEEEWED DELVMVPKQE FAEDFPVDDD DAYLDANDLE QILGSDTPDK VAPLPLDLHD  240
GDNLSSADVS TEMIEDHPQK LLMDEGENQH QAEKEDGPKL FDLPVQNEMD PKSVKHEYIG  300
ETNNASDFDV DYLLDEPFFD ASTGDFQFDA SSFLEADDLK NEVKTEPGLE MFDEYTSFIN  360
PTNNLEYTFD SIDNEDILPE SSLILENANE DTHDAIEATQ QFFEGQNCNI APAKVEQPDL  420
ATGNNVASSS GQEHQDSAPH EANEASQQPF EEFAYPFLQR ASYMLGNISA PPAFASEYPS  480
KYLAAAASQA STSVRVTTGM IRIRDVSFTG TKLDWSLGKN GHLDIVLSLR LDQDQNQNQS  540
VVGKGHSGVS QELVFLPVSV HHGCFVELPD QQSHLSKVIH ELKKENGQWS TTGGGYASAS  600
W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-501217411171NAC domain-containing protein 19
4dul_A2e-501217411171NAC domain-containing protein 19
1ut7_B2e-501217411171NO APICAL MERISTEM PROTEIN
1ut7_A2e-501217411171NO APICAL MERISTEM PROTEIN
1ut4_B2e-501217411171NO APICAL MERISTEM PROTEIN
1ut4_A2e-501217411171NO APICAL MERISTEM PROTEIN
3swp_D2e-501217414174NAC domain-containing protein 19
3swp_C2e-501217414174NAC domain-containing protein 19
3swp_B2e-501217414174NAC domain-containing protein 19
3swp_A2e-501217414174NAC domain-containing protein 19
3swm_D2e-501217414174NAC domain-containing protein 19
3swm_C2e-501217414174NAC domain-containing protein 19
3swm_B2e-501217414174NAC domain-containing protein 19
3swm_A2e-501217414174NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076897.11e-172PREDICTED: NAC domain-containing protein 78-like
TrEMBLA0A103YID60.0A0A103YID6_CYNCS; No apical meristem (NAM) protein
STRINGPGSC0003DMT4000797891e-165(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-127NAC domain containing protein 2