PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 251aa    MW: 28251.8 Da    PI: 7.3907
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58682396PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.51.4e-41163240178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cq+egC+adls ak+yhrrhkvCe+hska+ vl++gl+qr+CqqCsrfh l+efDe+krsCr+rLa+hn+rrrk+++
  Lsa008066 163 RCQIEGCNADLSLAKHYHRRHKVCEFHSKASIVLAAGLTQRYCQQCSRFHILEEFDEGKRSCRKRLADHNRRRRKSSQ 240
                6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-34159225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.282161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.68E-39162241IPR004333Transcription factor, SBP-box
PfamPF031109.2E-31164237IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MLNCERASPS TIMFNGDGGA GGGLEELISQ SIQKRDIFDQ HSHSFNDATI ATPVINSHDL  60
FHPHHRMLNN PNFYDPPPSA VDCVSPPSPF PPPLHSLDTN QAGFFLMPKL EHYGCNIDFS  120
NSLNLIGLNL AGHTYFPVGE DDIMNQLGRR SRSLEAGLMN SPRCQIEGCN ADLSLAKHYH  180
RRHKVCEFHS KASIVLAAGL TQRYCQQCSR FHILEEFDEG KRSCRKRLAD HNRRRRKSSQ  240
NESTMLINDQ P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-311642371184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023757531.10.0squamosa promoter-binding-like protein 8
RefseqXP_023757532.10.0squamosa promoter-binding-like protein 8
SwissprotQ8GXL34e-60SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A2J6LS240.0A0A2J6LS24_LACSA; Uncharacterized protein
STRINGcassava4.1_023056m7e-72(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-63squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]