PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family TCP
Protein Properties Length: 161aa    MW: 18705.6 Da    PI: 7.7009
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58666164PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP87.72.7e-27106159255
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqa 55 
                + kkd hski+T++g+RdRRvRls+e+ ++fF Lqd LGfdk+s+t++WL++++
  Lsa007740 106 TSKKDGHSKIYTARGPRDRRVRLSIEISRKFFCLQDLLGFDKPSQTLDWLFTKS 159
                78**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.1E-26106159IPR005333Transcription factor, TCP
PROSITE profilePS5136928.271108161IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MHSSNPFPQL PSSTVGFSHP NFFFYHEKDD VQYNYHRKND DPFISSDFLF HPYNSSTPPA  60
VMENVTTIKQ DFVRQQQFSE GSGLQCSEDH DLLDSVISPY NKRLATSKKD GHSKIYTARG  120
PRDRRVRLSI EISRKFFCLQ DLLGFDKPSQ TLDWLFTKSL X
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023746527.11e-116transcription factor CYCLOIDEA-like
TrEMBLA0A2J6MA451e-115A0A2J6MA45_LACSA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.17e-22TCP domain protein 12