PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007653
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 236aa    MW: 27231.1 Da    PI: 9.1822
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58679745PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.15.5e-29959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+nrqvtfskRr g+lKKA+E+SvLCda+v +iifs++gkl e++s
  Lsa007653  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVGLIIFSTKGKLCEFAS 59
               79***********************************************86 PP

2K-box1028e-3476173299
      K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                ++++++ ++e+   +++ e+akLk++ie Lq++q h++GedL+sLslkeLq+Le+q+++s+k+iR +Kn+l++e i+ lqkkek+lq++n++L+kk+ 
  Lsa007653  76 EERNNTTTDEESIGKWTLEHAKLKSRIELLQKTQSHVMGEDLDSLSLKELQNLEHQMDTSIKHIRLRKNQLMTETISMLQKKEKALQNQNNTLSKKII 173
                5566677889999***********************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.614161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-37160IPR002100Transcription factor, MADS-box
CDDcd002652.48E-38275No hitNo description
SuperFamilySSF554551.44E-32292IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.9E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.4E-2785172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.5288178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGRGRVTLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD ADVGLIIFST KGKLCEFASD  60
ASMESILERY ERHSYEERNN TTTDEESIGK WTLEHAKLKS RIELLQKTQS HVMGEDLDSL  120
SLKELQNLEH QMDTSIKHIR LRKNQLMTET ISMLQKKEKA LQNQNNTLSK KIIEVEKEQS  180
QQPPVEQQNN DNMPSLHFST FITTCEGRID GPEKAIPRKG QPSIVLPPWM LQHINQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-19181182MEF2 CHIMERA
6byy_B2e-19181182MEF2 CHIMERA
6byy_C2e-19181182MEF2 CHIMERA
6byy_D2e-19181182MEF2 CHIMERA
6bz1_A2e-19185186MEF2 CHIMERA
6bz1_B2e-19185186MEF2 CHIMERA
6bz1_C2e-19185186MEF2 CHIMERA
6bz1_D2e-19185186MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023767094.11e-175truncated transcription factor CAULIFLOWER A-like isoform X2
SwissprotQ424292e-98AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A2J6L6P71e-146A0A2J6L6P7_LACSA; Uncharacterized protein
STRINGXP_009625854.11e-106(Nicotiana tomentosiformis)
Publications ? help Back to Top
  1. Kang SG,Hannapel DJ
    Nucleotide sequences of novel potato (Solanum tuberosum L.) MADS-box cDNAs and their expression in vegetative organs.
    Gene, 1995. 166(2): p. 329-30
    [PMID:8543185]