PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007426
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family TCP
Protein Properties Length: 126aa    MW: 14098 Da    PI: 10.4732
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58693065PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP80.15.8e-252586465
        TCP  4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65
               +  r++ +hTkv+gR+ RvR++a+caar+F+L++eLG+ +d++tieWLl    p+     + 
  Lsa007426 25 AAARKKNRHTKVNGRGLRVRVPALCAARIFQLTRELGHRSDGQTIEWLLHHVDPSLFPTSSR 86
               56799*********************************************999987665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.6E-2028108IPR005333Transcription factor, TCP
PROSITE profilePS5136918.912983IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MDHLPPSTNN PLQLGPPNPT PTTSAAARKK NRHTKVNGRG LRVRVPALCA ARIFQLTREL  60
GHRSDGQTIE WLLHHVDPSL FPTSSRDSAV APENQRSSEL DLFPNLSFTS LLMQVEEDEI  120
KTKRKI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023753131.19e-89transcription factor TCP9-like
SwissprotO646472e-22TCP9_ARATH; Transcription factor TCP9
TrEMBLA0A2J6M2742e-87A0A2J6M274_LACSA; Uncharacterized protein
STRINGVIT_08s0040g01600.t014e-25(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72010.11e-24TCP family protein