PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007259
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 200aa    MW: 22408 Da    PI: 8.76
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S32125677PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-2577PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.71.9e-3924100177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +C v+gC+adl ++++yh+rhkvCevhsk+p+v ++ ++ rfCqqCsrfh l+efDe+krsCr+rL++hn+rrrk++
  Lsa007259  24 TCVVDGCTADLRNCRKYHQRHKVCEVHSKSPEVSIKTEKLRFCQQCSRFHPLDEFDEGKRSCRKRLDGHNRRRRKPR 100
                5**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.0E-311986IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.1542299IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.81E-3623103IPR004333Transcription factor, SBP-box
PfamPF031102.3E-302598IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MALSTSGSSK RVCSEINNSV QAATCVVDGC TADLRNCRKY HQRHKVCEVH SKSPEVSIKT  60
EKLRFCQQCS RFHPLDEFDE GKRSCRKRLD GHNRRRRKPR PYLFPANHHG TGVVQPSGPP  120
VHTAMASMTT SSVWSHLDHA PSLLSSSEAS FSHVVHPPSG SFSATISLEN DSDAGWGGMI  180
DTTSNYNQDP QEFPFYWRYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-2825981184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18198KRSCRKRLDGHNRRRRKP
29399RRRRKPR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023747241.11e-150squamosa promoter-binding-like protein 13A
RefseqXP_023747243.11e-150squamosa promoter-binding-like protein 13A
SwissprotB9DI209e-40SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI119e-40SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLA0A2J6JLH71e-149A0A2J6JLH7_LACSA; Uncharacterized protein
STRINGcassava4.1_009657m3e-45(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-41SBP family protein
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]