PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa006912
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 940aa    MW: 105462 Da    PI: 7.5268
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-13780PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.51.1e-39147223177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +Cqv++C++dls+ak+yhrrhkvC+ hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk++
  Lsa006912 147 VCQVDDCRTDLSNAKDYHRRHKVCDLHSKATKALVLNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKST 223
                6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-31141209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.633145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-36146224IPR004333Transcription factor, SBP-box
PfamPF031103.0E-28148221IPR004333Transcription factor, SBP-box
SuperFamilySSF484039.02E-9720828IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.1E-7735833IPR020683Ankyrin repeat-containing domain
CDDcd002046.09E-9736829No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 940 aa     Download sequence    Send to blast
MEARFGEKSH HYYGPVPVVS DLKAVGKRTM EWDLNDWKWD ADLFTATPSD YSSRQLFPVT  60
TSELQTNTGA SNSSSSCSVE INLQNQKGKR RVLVLDEEEV CGEAGALNLK LGAGGQVYPI  120
TEDEAERWEG KTGKKTKVAG TTSNRAVCQV DDCRTDLSNA KDYHRRHKVC DLHSKATKAL  180
VLNVMQRFCQ QCSRFHVLQE FDEGKRSCRR RLAGHNRRRR KSTHPENTVN GVSLNDEHGS  240
SYLLISLLRI LTNIHSNTSD QRSEQDLVTH LLKNLGNINA SNLSRLITGS QNFTNASTSI  300
PTLEKASQPL EYETMENGGA LQITDPSNNI IPFPPKSSPM EDTVGVGRMK FNTIDLNNAY  360
DDSQDCMETF DTFENTDNVP MWLRGGDPHK SSPPQTSGST ATQSPSSSSG EAQSRTDRIV  420
FKLFGKDPNE LPVLLRNQIL DWLSQSPSDI EGYIKPGCII LSVYLRMDNS SWDELCYDLS  480
SNLRKLLEAS SDSFWRTGWI YTRVLDHVAF ACDGQIVLNT SLPHNKNSTI LSVKPIAVSF  540
SETAQFSVKG FXLFMVNIKV DLCPRRQLPY PNKLLRCNRT VEIRRSSKSK TTTFQSLTFS  600
CSIPNIHGRG FIEIEDDSLS SSFFPFIVAE EDVCSEIRTL ETDIDDSKLE ARNQALEFIH  660
EMGWLLHRSQ LKSRLSSSMD PNSDLFSFDR FRWLIEFSVD HDWCRVVNKL LTLIFKGITV  720
INHTSVETAL LDIGLLHRAV RRNSRPMVEF LLNFRVPGPV LFKPDAVGPA GLTPLHIAAG  780
KDGSEDVLDA LTNDPQMVGV EAWRRSHDSS GLTPYDYASL RGHYPYIHLV QRKMNKNKGH  840
VVVDIPVKTK VKEGAELSLS FKGFEMEKAL VFKGRCNECE GKLGYYGGVR SSLAIYKPAM  900
LSMVAIAAVC VCVALLFKSS PQVMFVFQPF IWERLKYGAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-32142221584squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023764294.10.0squamosa promoter-binding-like protein 1 isoform X1
TrEMBLA0A2J6LCN60.0A0A2J6LCN6_LACSA; Uncharacterized protein
STRINGXP_002519316.10.0(Ricinus communis)
STRINGXP_004297083.10.0(Fragaria vesca)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1