PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa006790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 168aa    MW: 18638 Da    PI: 9.107
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58676506PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1339.8e-4264141178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cq+e+C+adl+eak+yhrrh+vCe h+ka+vv+v+g eqrfCqqCsrfhel efD++krsCrrrLa+hnerrrk+++
  Lsa006790  64 CCQAEKCTADLTEAKQYHRRHRVCELHAKAQVVIVAGNEQRFCQQCSRFHELLEFDDTKRSCRRRLAGHNERRRKSSS 141
                6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3358126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.93262139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.03E-3763142IPR004333Transcription factor, SBP-box
PfamPF031107.2E-3265138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MEAESTKASS KAKVKMKKVL MNEHHGDGLL GCDGGDNSGG SFDGNVKKKK CGHSGGGATS  60
GTRCCQAEKC TADLTEAKQY HRRHRVCELH AKAQVVIVAG NEQRFCQQCS RFHELLEFDD  120
TKRSCRRRLA GHNERRRKSS SEIKGTRKTL ACMEADGREM FQGSCERE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-3855138184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023743676.11e-119squamosa promoter-binding-like protein 3
SwissprotQ9S7582e-38SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A2J6JTX41e-118A0A2J6JTX4_LACSA; Uncharacterized protein
STRINGVIT_12s0028g03350.t011e-46(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.12e-40squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]
  3. Ioannidi E, et al.
    Trichome patterning control involves TTG1 interaction with SPL transcription factors.
    Plant Mol. Biol., 2016. 92(6): p. 675-687
    [PMID:27631431]
  4. Jung JH,Lee HJ,Ryu JY,Park CM
    SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering.
    Mol Plant, 2016. 9(12): p. 1647-1659
    [PMID:27815142]