PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa006636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 146aa    MW: 16561.1 Da    PI: 9.993
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-42045PU_refplantGDBView CDS
gnl|UG|Lsa#S32109064PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.24e-27959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               k+i+n + rqvtfskRr g+lKKA+EL vLCda+va+i+fs tgkl+eyss
  Lsa006636  9 KKIDNITARQVTFSKRRRGLLKKAQELAVLCDADVALIVFSATGKLFEYSS 59
               68***********************************************96 PP

2K-box28.75.6e-11981464694
      K-box  46 LslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                ++ +eL++Le+ Le +l+++ ++K+e + ++i++lq+k  +l een+ L
  Lsa006636  98 INQEELEHLETVLEGGLSRVLQTKDEKFGNEISRLQEKGAKLMEENRLL 146
                6789******************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.66161IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-31378IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-241057IPR002100Transcription factor, MADS-box
CDDcd002654.46E-321275No hitNo description
PRINTSPR004044.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.60455146IPR002487Transcription factor, K-box
PfamPF014864.2E-896146IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MAREKIKIKK IDNITARQVT FSKRRRGLLK KAQELAVLCD ADVALIVFSA TGKLFEYSSS  60
SMQEMLGKYK LHSSNNRDKV DDPSLNLEAV KRPRASGINQ EELEHLETVL EGGLSRVLQT  120
KDEKFGNEIS RLQEKGAKLM EENRLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A1e-21197195MEF2 CHIMERA
6bz1_B1e-21197195MEF2 CHIMERA
6bz1_C1e-21197195MEF2 CHIMERA
6bz1_D1e-21197195MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023735759.14e-81MADS-box protein JOINTLESS-like
SwissprotQ9FUY69e-52JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLA0A2U1NGV52e-67A0A2U1NGV5_ARTAN; AGAMOUS-like 24
STRINGEOY154441e-55(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.16e-54MIKC_MADS family protein
Publications ? help Back to Top
  1. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]