PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa006566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 306aa    MW: 34647.8 Da    PI: 7.3193
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58683042PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-26505PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.13e-31129182255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt+ LH++F++av+ LGG+e+AtPk++ elm+vk+Ltl+hvkSHLQ+YR+
  Lsa006566 129 PRMRWTSSLHAHFIHAVQLLGGHERATPKSVQELMNVKDLTLAHVKSHLQMYRT 182
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-27127183IPR009057Homeodomain-like
SuperFamilySSF466891.08E-14127183IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23129182IPR006447Myb domain, plants
PfamPF002493.4E-7130181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MTNNEATTFP DLSLQISPPF AADEYNMTGC IIKRPPSTSS SSSDLSQENT FNHHHYQQLI  60
AADMDGFVNH GLQFDQQQPQ LTLGPEMGAL NDCHPNHHYH PRGPRQIYSY DFKRSSRMVN  120
SVRRGARAPR MRWTSSLHAH FIHAVQLLGG HERATPKSVQ ELMNVKDLTL AHVKSHLQMY  180
RTVKSTDRGG AVALTDTQVI NPRAPISLFE VEGDISPSTT LHISQRRSFE SSLETNDLSY  240
TMKKNVSSDY PISIHTSEAD DEHEVTLSLS KKIKMLENNR TYSSSERLLN LEFTLGRPCR  300
QLDQIF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103XD251e-95A0A103XD25_CYNCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.14e-46G2-like family protein