PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005715
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28361.6 Da    PI: 8.8682
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S29964402PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-20460PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.29.1e-233888151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               kri++ks r vtfskRr+g++KKA  LSv Cd++va  ++s +gklye++s
  Lsa005715 38 KRIQDKSSRLVTFSKRRTGLFKKARHLSVICDVDVAAFVISDSGKLYEFCS 88
               79***********************************************96 PP

2K-box29.23.9e-111441994499
      K-box  44 esLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                ++ s+ ++ +Le++L+ +l + RskK++l++e +++  ++ ++l ee+++L+++l+
  Lsa005715 144 NEVSVSDMTKLEEELHAALLHTRSKKTQLMVERMSTFHEQVRKLTEEKEELKQQLQ 199
                78899************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-313089IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.16E-2530105IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.1653090IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-213252IPR002100Transcription factor, MADS-box
PfamPF003195.3E-213986IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-215267IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-216788IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.503111204IPR002487Transcription factor, K-box
PfamPF014867.3E-8141198IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
XGGFCERAGD QKLELRVRRL IHPSAGREKM GRRKLEIKRI QDKSSRLVTF SKRRTGLFKK  60
ARHLSVICDV DVAAFVISDS GKLYEFCSGG YNSNSVELIL SRYQAEERTT QEGAFEDMAF  120
NKSTRFRTCK ELLKSVRRVD EQPNEVSVSD MTKLEEELHA ALLHTRSKKT QLMVERMSTF  180
HEQVRKLTEE KEELKQQLQV ASAKKNQKDD VDDDGGEGLD HSANSHSYYQ TNLYPPQPLL  240
TLPLXQE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-133088159MEF2 CHIMERA
6byy_B1e-133088159MEF2 CHIMERA
6byy_C1e-133088159MEF2 CHIMERA
6byy_D1e-133088159MEF2 CHIMERA
6bz1_A9e-143088159MEF2 CHIMERA
6bz1_B9e-143088159MEF2 CHIMERA
6bz1_C9e-143088159MEF2 CHIMERA
6bz1_D9e-143088159MEF2 CHIMERA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023732397.11e-159agamous-like MADS-box protein AGL27 isoform X1
TrEMBLA0A2J6MCW01e-157A0A2J6MCW0_LACSA; Uncharacterized protein