PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 232aa    MW: 26874.7 Da    PI: 9.1869
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-8377PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.91.2e-27959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               k+ien++nrqvt+skRrng++KKA+EL vLCda+v++i++s t+kl+ey+s
  Lsa005566  9 KKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYIS 59
               68***********************************************86 PP

2K-box75.41.6e-2571168198
      K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                yqk++g +l++++++++q+el++ k+ ++nL++++R++lG++Le+L+++eL  Le++ ++++  iR++K +++ +++e+++kk +++q+  k+L +++
  Lsa005566  71 YQKATGIDLWNSHYQKMQEELRQQKEGNRNLRKQIRQRLGDCLEDLNFEELLALEKDSQEAVYIIRERKLKVIGNKVETSKKKVRSAQDVYKKLMHEF 168
                89999*****************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.319161IPR002100Transcription factor, MADS-box
SMARTSM004329.3E-38160IPR002100Transcription factor, MADS-box
CDDcd002654.41E-38280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.94E-36395IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003195.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-263859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-1482168IPR002487Transcription factor, K-box
PROSITE profilePS5129713.68384174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MARGKIQIKK IENSTNRQVT YSKRRNGLFK KASELTVLCD AKVSIIMVSC TDKLHEYISP  60
SITMKQFFDQ YQKATGIDLW NSHYQKMQEE LRQQKEGNRN LRKQIRQRLG DCLEDLNFEE  120
LLALEKDSQE AVYIIRERKL KVIGNKVETS KKKVRSAQDV YKKLMHEFDL RGEDPQYGMI  180
EDGLEYENVY GYPQISPPNI LTLRLQSEHP NNLHIVPGGA NASDMTTYGL LG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the genetic control of flower development. Acts in conjunction with GLOBOSA (glo).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024976425.11e-157floral homeotic protein DEFICIENS-like
SwissprotP237064e-96DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLA0A2U1MBS21e-156A0A2U1MBS2_ARTAN; MADS-box transcription factor CDM19
STRINGXP_009794650.12e-97(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.16e-89MIKC_MADS family protein
Publications ? help Back to Top
  1. Schwarz-Sommer Z, et al.
    Characterization of the Antirrhinum floral homeotic MADS-box gene deficiens: evidence for DNA binding and autoregulation of its persistent expression throughout flower development.
    EMBO J., 1992. 11(1): p. 251-63
    [PMID:1346760]
  2. Sommer H, et al.
    Deficiens, a homeotic gene involved in the control of flower morphogenesis in Antirrhinum majus: the protein shows homology to transcription factors.
    EMBO J., 1990. 9(3): p. 605-13
    [PMID:1968830]
  3. Gallois JL, et al.
    Functional characterization of the plant ubiquitin regulatory X (UBX) domain-containing protein AtPUX7 in Arabidopsis thaliana.
    Gene, 2013. 526(2): p. 299-308
    [PMID:23747397]
  4. Davies B,Egea-Cortines M,de Andrade Silva E,Saedler H,Sommer H
    Multiple interactions amongst floral homeotic MADS box proteins.
    EMBO J., 1996. 15(16): p. 4330-43
    [PMID:8861961]