PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 218aa    MW: 24301.9 Da    PI: 4.8508
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-9340PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like871.8e-27152206156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++ +Lt+++++SHLQkYR++
  Lsa005369 152 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIGCLTRHNIASHLQKYRSH 206
                5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.666149208IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-26150209IPR009057Homeodomain-like
SuperFamilySSF466897.97E-19150209IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-26152206IPR006447Myb domain, plants
PfamPF002494.5E-8155204IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MLAVVSPLEN NTGRDGRDLG GEMVGFSVGD DFPDFSDDNL LESIDFDDLF VGMDDRDMLP  60
DLEMDPELMA GEFSLSGGED SSDQFNNNSM NSFSSSDQKA EDLISRKEEV VSKRDRRNEG  120
GATNPAHKEK DADRGRKSSS DKSKNSCQGK RKVKVDWTPE LHRRFVQAVE QLGVDKAVPS  180
RILEIMGIGC LTRHNIASHL QKYRSHRKHL LAREAEAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-15149204257ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601765.12e-78PREDICTED: transcription activator GLK1-like
RefseqXP_016499361.12e-78PREDICTED: transcription activator GLK1-like
SwissprotQ9SIV34e-56GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A103XTP91e-125A0A103XTP9_CYNCS; Homeodomain-like protein
STRINGPOPTR_0007s01230.12e-75(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-51GBF's pro-rich region-interacting factor 1