PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005319
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 265aa    MW: 30718.2 Da    PI: 8.9537
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58673160PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.81e-49391642128
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101
                +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + + + + +g
  Lsa005319  39 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTDNFRSIG 137
                79***************************.89***************8778899***************************************999**** PP

        NAM 102 lkktLvfykgrapkgektdWvmheyrl 128
                lkktLvfy+g+apkg +t+W+m+eyrl
  Lsa005319 138 LKKTLVFYSGKAPKGIRTSWIMNEYRL 164
                *************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.40838185IPR003441NAC domain
SuperFamilySSF1019411.7E-5538184IPR003441NAC domain
PfamPF023653.5E-2540164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
XISQRFMAIG ARTMNQEEEI RNKKQQEDDD DDHENDMVMP GFRFHPTEEE LVEFYLRRKV  60
EGKRFNVELI TFLDLYRYDP WELPALAAIG EKEWFFYVPR DRKYRNGDRP NRVTTSGYWK  120
ATGADRMIRT DNFRSIGLKK TLVFYSGKAP KGIRTSWIMN EYRLPQHETE RLQKAEISLC  180
RVYKRAGVED HPCLPRTLPT TRASIFSARA SNADKKQHSK NLLSFQSSLE QQQGQSSNQQ  240
NDEKLSETSG SSTTDIVGTA LGLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-564018519165NO APICAL MERISTEM PROTEIN
1ut4_B2e-564018519165NO APICAL MERISTEM PROTEIN
1ut7_A2e-564018519165NO APICAL MERISTEM PROTEIN
1ut7_B2e-564018519165NO APICAL MERISTEM PROTEIN
3swm_A2e-564018522168NAC domain-containing protein 19
3swm_B2e-564018522168NAC domain-containing protein 19
3swm_C2e-564018522168NAC domain-containing protein 19
3swm_D2e-564018522168NAC domain-containing protein 19
3swp_A2e-564018522168NAC domain-containing protein 19
3swp_B2e-564018522168NAC domain-containing protein 19
3swp_C2e-564018522168NAC domain-containing protein 19
3swp_D2e-564018522168NAC domain-containing protein 19
4dul_A2e-564018519165NAC domain-containing protein 19
4dul_B2e-564018519165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078843.11e-133PREDICTED: NAC domain-containing protein 55-like
RefseqXP_012078844.11e-133PREDICTED: NAC domain-containing protein 55-like
SwissprotQ9FIW52e-62NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A118IN541e-159A0A118IN54_CYNCS; No apical meristem (NAM) protein
STRINGGLYMA17G00650.21e-131(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-112NAC domain containing protein 35