PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005206
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NAC
Protein Properties Length: 171aa    MW: 19938.7 Da    PI: 9.6368
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58668877PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM139.22.6e-4391412127
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkk...leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                +pGfrF Pt+eel+++yLk+k++g++    ++++vi+++++y++ PwdLp+    +++++ ++w+fF++r++k+a+g r++r t+sgyWkatg+   v+s
  Lsa005206   9 APGFRFYPTEEELITFYLKHKIQGTTrllQHIDRVIPRLHVYDFYPWDLPQyageRCQGDLEQWFFFIPRQEKEARGGRPSRLTSSGYWKATGSPSIVYS 108
                59***********************9997777789***************646665566777************************************** PP

        NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyr 127
                 +++++g+k+t+vfy+grap+g+kt+W m+ey+
  Lsa005206 109 WNNRAIGIKRTMVFYNGRAPSGTKTKWKMNEYK 141
                ********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.4778169IPR003441NAC domain
SuperFamilySSF1019411.83E-478169IPR003441NAC domain
PfamPF023655.5E-2310141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MEGEGVVGAP GFRFYPTEEE LITFYLKHKI QGTTRLLQHI DRVIPRLHVY DFYPWDLPQY  60
AGERCQGDLE QWFFFIPRQE KEARGGRPSR LTSSGYWKAT GSPSIVYSWN NRAIGIKRTM  120
VFYNGRAPSG TKTKWKMNEY KAFQEVPSSN SNPRPELMEE LSLCRVYVKS N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-351017119167NO APICAL MERISTEM PROTEIN
1ut4_B1e-351017119167NO APICAL MERISTEM PROTEIN
1ut7_A1e-351017119167NO APICAL MERISTEM PROTEIN
1ut7_B1e-351017119167NO APICAL MERISTEM PROTEIN
3swm_A1e-351017122170NAC domain-containing protein 19
3swm_B1e-351017122170NAC domain-containing protein 19
3swm_C1e-351017122170NAC domain-containing protein 19
3swm_D1e-351017122170NAC domain-containing protein 19
3swp_A1e-351017122170NAC domain-containing protein 19
3swp_B1e-351017122170NAC domain-containing protein 19
3swp_C1e-351017122170NAC domain-containing protein 19
3swp_D1e-351017122170NAC domain-containing protein 19
4dul_A1e-351017119167NAC domain-containing protein 19
4dul_B1e-351017119167NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243510.18e-74PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR34e-67NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A103Y6R11e-102A0A103Y6R1_CYNCS; No apical meristem (NAM) protein
STRINGSolyc11g068620.1.12e-70(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-68NAC domain containing protein 90