PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa004969
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NF-YA
Protein Properties Length: 256aa    MW: 28871.5 Da    PI: 9.8886
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58679251PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-3421PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.41.8e-31168224158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep++VNaKQy++Il+RRq Rak+e+e+k  +ksrkpylheSRh hAlrR Rg+gGrF
  Lsa004969 168 EEPVFVNAKQYHGILRRRQCRAKAESEHKA-NKSRKPYLHESRHLHALRRSRGCGGRF 224
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-33166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.135167227IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.6E-27169224IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.6E-23170192IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860172192IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.6E-23201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
XSGETVTRAE LVHNIPXAKR QLSHQGHRIK QTQKRKTSNI NLSFKLLTEN QVHQNCGSHS  60
IMSSSAPEFS DNSESEMQQS QMEGQIQCSS SPATTTTTGT SHPSNIQYPT LGQAAYPFPD  120
PYYRGTNIFN PYETQSYPAQ PYPGQPMVHL QFMGIQQAGV PLPSDTVEEP VFVNAKQYHG  180
ILRRRQCRAK AESEHKANKS RKPYLHESRH LHALRRSRGC GGRFEKKDKQ QKEKGSNDNN  240
PQSQSQMNIN LNSDKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-19167224158NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023734088.11e-145nuclear transcription factor Y subunit A-7-like isoform X2
SwissprotQ84JP12e-53NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A2J6MCI01e-129A0A2J6MCI0_LACSA; Uncharacterized protein
STRINGVIT_10s0003g04650.t011e-79(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.21e-52nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]