PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa004740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 151aa    MW: 17241.1 Da    PI: 7.3654
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-27702PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.81.3e-4267143177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +CqvegC+ad+s++k+yhrrhkvCe hskapvv++ g +qrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk++
  Lsa004740  67 CCQVEGCTADMSNCKTYHRRHKVCELHSKAPVVITGGYQQRFCQQCSRFHDLIEFDNAKRSCRRRLAGHNERRRKSS 143
                6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.6E-5812151IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.105.9E-3560129IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.55665142IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-3966147IPR004333Transcription factor, SBP-box
PfamPF031108.3E-3368141IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
METTKSGRVV RSMNDMLKNE MIEYGEEEEE EGGEEEDDDE NFGEGSRKKK VMRRRGSGSG  60
GGSVQPCCQV EGCTADMSNC KTYHRRHKVC ELHSKAPVVI TGGYQQRFCQ QCSRFHDLIE  120
FDNAKRSCRR RLAGHNERRR KSSFETYGDG S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3758141184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023746857.11e-107squamosa promoter-binding protein 1-like
SwissprotQ387418e-48SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A2J6JMA85e-77A0A2J6JMA8_LACSA; Uncharacterized protein
STRINGEOY282002e-46(Theobroma cacao)
STRINGXP_010260271.13e-46(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-41squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]