PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa004503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 1056aa    MW: 116783 Da    PI: 8.07
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58696672PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-44548PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.3e-41158235178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqv++C++dls+ak+yhrrhkvCevhska ++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Lsa004503 158 MCQVDNCKEDLSTAKDYHRRHKVCEVHSKAGKALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 235
                6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.2E-33154220IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.872156233IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-37157237IPR004333Transcription factor, SBP-box
PfamPF031108.2E-30159232IPR004333Transcription factor, SBP-box
SuperFamilySSF484037.75E-6835936IPR020683Ankyrin repeat-containing domain
CDDcd002048.25E-5840935No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1056 aa     Download sequence    Send to blast
MEEVGTQLAP PLYMYNTIGA GRFPDAHPMA KKRSLPYQNP NLIQHQQQQQ YLQRLIPTLN  60
EPRNSWNPKN WEWDSSRLVA KPLDMMEISR EQQQQQHHHQ TAVNPPNPDG SKKSPVGQRE  120
EDERLLLKLG GGEEAATRPS KRVRSGSPGS GCAGNYPMCQ VDNCKEDLST AKDYHRRHKV  180
CEVHSKAGKA LVGKQMQRFC QQCSRFHPLS EFDEGKRSCR RRLAGHNRRR RKTQPEDVAL  240
QLLIPGNGDK NGANDMDIVG LLTVLARAQG NAEDMSRNSS PLPNKDQLMQ ILNKINSLPL  300
PVDPGSKQPV PGSLTNVDQE KTSSEVQKVN KKTSSSTMDF LGVLSGSSDA PEPLSQKRNQ  360
VIEADKNKTN SGCVNQTMVH SGGERSSTSF QSREDSDCQV MDTPLNLQLQ LFSSSPEDDS  420
PPKLASSRKY FSSDSSNPME DRSPSSSPPV VQRLFPTKAS RERMKPESMS TSGEVTANVK  480
ATMSLELFGG MNNGADNVSI QSSPYRAGYT SSSGSDQSPS SLNSDPQDRT GRLSFKLFDK  540
DPSHLPGSLR TQVYNWLSQS PSEMEGYIKP GCVVLSIYLS MSSSSWDQLE GNFLQYINAL  600
VQESGTDFWG SGRFLAHTEK QIASHKDGKV HLFKSLKAWS SPQLISISPL AVVSGKETSF  660
VLRGRNLRTP GTKIYCTHAD GCILEEATES TDQDSTYEEI STRRFTICAP SERGRCFIEI  720
ENGFRGTSFP IIIADSTLCQ ELNLLEAEFG EVQNRQPSLV KETIHFLNEL GWLFQKKNGG  780
SGSHYSLTRF KFLLVFSVER DLCGLVKTLL GILLQKGSGG ITEDDSSMEM LYTINLLNRA  840
VKRKCKNMVD LLIHYSVVGD TDTDSAASRK YIFPPNLAGP GGITPLHLAA CTSDSDDMVD  900
ALTNDPNEVG LLSWNSSLDA NGLSPFVYAT MRNNNSYNTL VAQKLANRIA GQVSVHISNE  960
IELQTARRVD HVDHHELSFR VRDHHVGTKS CSKCAIVTAK HPRRIPGSQG LLHRPYIHSM  1020
LAIAAVCVCV CLFLRGAPNI GLVAPFKWEN LNFGSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-30146232184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023772722.10.0squamosa promoter-binding-like protein 14
RefseqXP_023772793.10.0squamosa promoter-binding-like protein 14
RefseqXP_023772852.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2J6MJI40.0A0A2J6MJI4_LACSA; Uncharacterized protein
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]