PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa004130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Trihelix
Protein Properties Length: 466aa    MW: 53293.4 Da    PI: 5.9112
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-4356381PU_refplantGDBView CDS
gnl|UG|Lsa#S58680623PU_unrefUnigeneView CDS
gnl|UG|Lsa#S58657935PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix108.25.3e-34244329187
   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                rW+k e+ aLi++r++++ +++++ +k+plWee+s++mr+ g++r++k+Ckekwen+nk+ykk+k+g+kkr +e+s+tcpyf+ql+a
  Lsa004130 244 RWPKAEINALITLRTQLDMNYQENTAKGPLWEEISAAMRKLGYNRNAKRCKEKWENINKYYKKMKDGNKKR-PEDSKTCPYFHQLDA 329
                8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.2E-4241303IPR001005SANT/Myb domain
CDDcd122033.48E-26243308No hitNo description
PROSITE profilePS500907.097243301IPR017877Myb-like domain
PfamPF138373.5E-24244330No hitNo description
Gene3DG3DSA:1.10.10.608.2E-4244301IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
XVMAVMPPQP VMNQKRTFPF SQPNMSGSTN SATSSDTFSD DEPPQKKRKW QDFFGKLMKE  60
VIEKQEELQK RFLDTIERRE RDRVAREEAW RAQEIAKMNQ EHDRLVKERS IAAAKDAAVI  120
TFLQKMTGKN PDTVDXNKKK ASRYCRTYSI VIVTVQKFFS MKSWINXVDF INLTVFFVDF  180
LAPPIPLAST LPVIQQQQIH QTPPPPPPPR HEILQVAVPP SPMVKNLDGD VSGGDNMLLP  240
SPSRWPKAEI NALITLRTQL DMNYQENTAK GPLWEEISAA MRKLGYNRNA KRCKEKWENI  300
NKYYKKMKDG NKKRPEDSKT CPYFHQLDAI YREKATAIVA RPEQQWPPAT MVQEKTPPPP  360
PPQQQQQQQS TNGVYVEKRD DYPGFTGKPE TQTAPVVAWP QQQWRVPAAL QETQQQPQPQ  420
SAADMEDQGS ENTDDYDDDD DEDEDKEEEG GGYEIVASKI SSVATV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023758037.10.0trihelix transcription factor GT-2-like
TrEMBLA0A2J6LR210.0A0A2J6LR21_LACSA; Uncharacterized protein
STRINGSolyc12g056510.1.11e-90(Solanum lycopersicum)