PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa003864
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 220aa    MW: 25005.2 Da    PI: 8.1229
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58683547PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.45.9e-26959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krie+ks rqvtfskRr g+ KKA  LS+LCda vav++fss+gklyey+s
  Lsa003864  9 KRIEDKSSRQVTFSKRRSGLNKKARQLSILCDAAVAVVVFSSNGKLYEYCS 59
               79***********************************************96 PP

2K-box33.91.3e-121191744499
      K-box  44 esLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                + +s+ ++ +Le++L  +l + R++K++l++e i+   ++e++l+ee+++L+++l+
  Lsa003864 119 NVISVSDMTELEEELSAALMHTRARKTQLMMERISSFHEQERKLSEEKEELKQQLQ 174
                567999***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.3E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.506161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-29276IPR002100Transcription factor, MADS-box
CDDcd002655.13E-37276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.91284179IPR002487Transcription factor, K-box
PfamPF014862.9E-10109173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MGRRKLEMKR IEDKSSRQVT FSKRRSGLNK KARQLSILCD AAVAVVVFSS NGKLYEYCSG  60
GTNRVEDIIS RYHKSSLDAE ERTTQEGACQ NMGINNTCTR FQTCNELLHS VRRLDEKGNV  120
ISVSDMTELE EELSAALMHT RARKTQLMME RISSFHEQER KLSEEKEELK QQLQVASAAN  180
PNDDVDVGGQ RGRLEDTADN QYCGQTTPPR RLITLPLFKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A8e-18183180MEF2 CHIMERA
6byy_B8e-18183180MEF2 CHIMERA
6byy_C8e-18183180MEF2 CHIMERA
6byy_D8e-18183180MEF2 CHIMERA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023752455.11e-163agamous-like MADS-box protein AGL27
TrEMBLA0A2J6M3A41e-162A0A2J6M3A4_LACSA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65050.21e-35AGAMOUS-like 31